Recombinant Leptosira terrestris ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Pleurastrum terricola (Filamentous green alga) (Leptosira terrestris)
Target Names
atpF
Target Protein Sequence
MEVFMVSFTLLLGESTFSLGEGFGINTNVFETNIINLSVVLGLVFTLGRNFLISLLDARK ETILRNFREADQRAKDAEARLNLAKTELELAEKSAMEIKKQSVLSAELEKKNKNTKIEAD TARFKQTQQETLTVQRQRAISKISKQVVNSAITQVKQKLKSSLDSRVQTVINNYKIHKFI EYKPPGN
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These domains are connected by a central and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the relationship between Leptospira proteins and ATP synthase components?

While both topics appear in this FAQ collection, it's important to clarify that Leptospira (a bacterial pathogen) and chloroplastic ATP synthase (found in photosynthetic organisms) are distinct research areas. The search results indicate no direct relationship between Leptospira and chloroplastic atpF. Leptospira are spirochete bacteria that cause leptospirosis and have their own ATP synthesis machinery, while chloroplastic ATP synthase exists in photosynthetic eukaryotes. Researchers may independently study recombinant protein production techniques applicable to both systems, but they represent separate biological domains .

What is the function of ATP synthase subunit b in chloroplasts?

ATP synthase subunit b, encoded by the atpF gene, serves as a critical component of the peripheral stalk in chloroplast ATP synthase. This peripheral stalk acts as a stationary structure that prevents rotation of specific parts of the complex while allowing the central rotor to turn, thereby enabling the conversion of proton gradient energy into ATP synthesis. Research shows that subunit b (along with its partner subunit b′ encoded by ATPG) forms a crucial structural element that connects the membrane-embedded Fo sector with the catalytic F1 sector of the ATP synthase complex. Without functional atpF, the entire ATP synthase complex fails to assemble properly, severely compromising photosynthetic energy conversion .

How are recombinant proteins from Leptospira used in vaccine development?

Recombinant proteins from Leptospira, particularly immunoglobulin-like (Lig) proteins, serve as promising vaccine candidates against leptospirosis. Research has demonstrated that specific domains of LigB proteins can induce protective immunity in animal models. When properly designed as chimeric constructs, these recombinant proteins can present multiple epitopes to the immune system while maintaining structural integrity. For example, the chimeric protein LigB10-B7-B7 showed superior protection compared to individual domain constructs in hamster models, significantly reducing bacterial burden in tissues and preventing histopathological changes in organs typically affected by leptospiral infection .

What experimental models are used to study leptospiral proteins and ATP synthase components?

For leptospiral proteins, the golden hamster model represents the standard for testing vaccine efficacy. Researchers typically challenge immunized animals with virulent Leptospira strains and assess survival rates, bacterial burden in tissues (using RT-qPCR for LipL32 gene detection), and histopathological changes in target organs like liver, kidney, and lungs. For ATP synthase studies, Chlamydomonas reinhardtii serves as an excellent model organism due to its well-characterized chloroplast genome and established transformation techniques. Phenotypic screening for high light sensitivity has proven effective for isolating ATP synthase mutants, while CRISPR-Cas9 genome editing allows targeted disruption of specific ATP synthase subunit genes .

How do chimeric recombinant Leptospira antigens improve vaccine efficacy?

Chimeric recombinant Leptospira antigens enhance vaccine efficacy through several sophisticated mechanisms. By incorporating multiple epitopes onto a homologous scaffold, these constructs maintain the structural integrity of antigenic surfaces while presenting diverse immunogenic regions. Research demonstrates that the chimeric LigB10-B7-B7 construct incorporates three segments encompassing 900-2000 Ų surface areas, potentially creating full conformational epitopes. This approach yields superior protection compared to longer multi-domain constructs (e.g., LigB7-12, LigB1-7), possibly because single-domain antigens better expose critical epitopes that might otherwise be blocked by host factors such as extracellular matrix or serum proteins. Additionally, this design permits conscious limitation of host-interacting sites that might interfere with immune recognition while preserving protective epitopes .

What are the molecular mechanisms underlying chloroplast ATP synthase biogenesis?

Chloroplast ATP synthase biogenesis involves a complex interplay between nuclear and plastid gene expression systems. The search results reveal that peripheral stalk subunits play critical roles in this process. In Chlamydomonas reinhardtii, both plastid-encoded atpF (subunit b) and nuclear-encoded ATPG (subunit b′) are essential for ATP synthase assembly and function. Knockout mutations in either gene prevent ATP synthase accumulation, while knockdown mutations (e.g., transposon insertion in ATPG 3′UTR) allow minimal complex formation. Furthermore, post-transcriptional regulation by nuclear-encoded RNA-binding proteins like MDE1 (an octotricopeptide repeat protein) is crucial - MDE1 specifically stabilizes atpE mRNA by targeting its 5′UTR. The FTSH protease also contributes significantly to concerted accumulation of ATP synthase subunits, with AtpH identified as an FTSH substrate. This nucleus/chloroplast interplay represents a relatively recent evolutionary development (~300 million years ago), highlighting the ongoing refinement of organellar biogenesis mechanisms .

What methodological approaches optimize structural characterization of recombinant Leptospira antigens?

Optimal structural characterization of recombinant Leptospira antigens employs complementary techniques to elucidate structure-function relationships. Researchers have successfully used low-resolution structural approaches including small-angle X-ray scattering (SAXS) to determine the elongated conformation of LigB domains, revealing important insights about domain organization and accessibility of host-interacting regions. High-resolution structures of individual Ig-like domains (e.g., LigB12) provide templates for rational vaccine design by identifying surface-exposed regions suitable for epitope grafting. Monoclonal antibody binding studies complement structural data by mapping immunologically relevant regions. For chimeric constructs, verification of proper folding using circular dichroism spectroscopy ensures that grafted epitopes maintain native-like conformations. Surface plasmon resonance and isothermal titration calorimetry can evaluate binding interactions with host molecules, while hydrogen-deuterium exchange mass spectrometry offers insights into protein dynamics and solvent accessibility of potential epitopes .

How do nuclear-encoded factors regulate chloroplast ATP synthase assembly?

Nuclear-encoded factors execute sophisticated control over chloroplast ATP synthase assembly through multiple regulatory mechanisms. The MDE1 protein exemplifies this control - as an octotricopeptide repeat (OPR) protein, it specifically stabilizes the chloroplast-encoded atpE mRNA by targeting its 5′UTR region. Without MDE1, atpE transcripts fail to accumulate, completely preventing ATP synthase biogenesis despite the presence of other components. This represents a critical checkpoint in the coordinated production of ATP synthase subunits from both genomes. Additionally, nuclear-encoded ATPG (encoding subunit b′) works in concert with plastid-encoded atpF to form the peripheral stalk, a critical structural element. The nuclear-encoded FTSH protease further regulates ATP synthase accumulation by degrading excess unassembled subunits, particularly AtpH, ensuring stoichiometric assembly of the complex. Crossing ATP synthase mutants with ftsh1-1 mutants demonstrated that FTSH significantly contributes to the concerted accumulation of ATP synthase subunits. These multilayered regulatory mechanisms exemplify the sophisticated nuclear control over organellar biogenesis that evolved following endosymbiosis .

What experimental approaches can quantify protection conferred by recombinant Leptospira vaccines?

  • Bacterial burden quantification: Real-time quantitative reverse transcription PCR (RT-qPCR) targeting Leptospira-specific genes like LipL32 in liver, kidney, and urinary bladder tissues provides precise bacterial load measurements.

  • Histopathological scoring: Systematic evaluation of tissue sections from key target organs (lungs, liver, kidneys) for pathological changes including:

    • Lung: Alveolar septa thickening, interstitial leukocyte infiltration, endothelial cell swelling, hemorrhage

    • Liver: Inflammatory cell infiltration, focal necrosis, tissue integrity loss

    • Kidney: Tubulointerstitial nephritis, hemorrhage in uriniferous spaces/tubules, tubular loss, lymphoplasmacytic cell infiltration, fibrosis

  • Macroscopic lesion assessment: Evaluation of gross pathological changes such as pulmonary ecchymoses, liver icterus, and kidney enlargement.

  • Serological responses: Measurement of antibody titers using ELISA against both the vaccine antigen and whole-cell Leptospira preparations.

These complementary approaches provide comprehensive quantification of vaccine efficacy beyond simple survival statistics .

What genetic engineering strategies optimize chimeric antigen design for Leptospira vaccines?

Optimizing chimeric antigen design for Leptospira vaccines requires sophisticated genetic engineering approaches informed by structural and immunological data. Successful strategies include:

What techniques are most effective for studying ATP synthase mutants in photosynthetic organisms?

Studying ATP synthase mutants in photosynthetic organisms requires a comprehensive technical approach combining genetic, biochemical, and physiological methods:

  • Mutant generation and screening:

    • High light sensitivity screening provides an effective phenotypic selection for ATP synthase mutants

    • CRISPR-Cas9 genome editing enables precise targeted disruption of specific ATP synthase genes

    • Whole-genome sequencing confirms mutation identity and excludes off-target effects

  • Functional characterization:

    • Oxygen evolution measurements quantify photosynthetic capacity

    • Chlorophyll fluorescence analysis (PAM fluorometry) assesses photosystem II efficiency and proton gradient formation

    • Electrochromic shift measurements evaluate proton motive force generation

  • Biochemical analysis:

    • Blue native gel electrophoresis visualizes intact ATP synthase complex assembly

    • Mass spectrometry determines subunit composition and stoichiometry

    • Western blotting with subunit-specific antibodies quantifies individual protein accumulation

  • Genetic complementation:

    • Transformation with wild-type or chimeric genes validates causality of mutations

    • Controlled expression systems permit titration of protein levels

    • Creation of tagged versions enables in vivo localization studies

  • RNA analysis:

    • Northern blotting quantifies transcript accumulation

    • RNA stability assays measure post-transcriptional regulation

    • RNA immunoprecipitation identifies RNA-protein interactions

Chlamydomonas reinhardtii serves as an excellent model organism for these studies due to its well-established genetic tools and the availability of chloroplast transformation techniques .

How can researchers analyze the interaction between nuclear and chloroplast genomes in ATP synthase assembly?

Analyzing nuclear-chloroplast genome interactions in ATP synthase assembly requires sophisticated experimental approaches that bridge molecular genetics, biochemistry, and evolutionary analysis:

  • Genetic crossing experiments:

    • Crossing nuclear mutants (e.g., ATPG, MDE1) with chloroplast mutants (e.g., atpF)

    • Analysis of epistatic relationships reveals hierarchical assembly dependencies

    • Tetrad analysis in Chlamydomonas enables precise genetic segregation studies

  • RNA-protein interaction studies:

    • RNA immunoprecipitation followed by sequencing (RIP-seq) identifies direct binding of nuclear-encoded factors to chloroplast transcripts

    • In vitro binding assays with recombinant proteins validate specific interactions

    • Structure-function analysis with mutated binding sites confirms specificity

  • Protein import and assembly kinetics:

    • Pulse-chase experiments with radiolabeled precursors track assembly intermediates

    • Biochemical isolation of assembly intermediates identifies assembly pathways

    • Time-resolved proteomic analysis reveals assembly order and interdependencies

  • Evolutionary genomic approaches:

    • Comparative analysis across algal lineages reveals co-evolution of interacting factors

    • Ancestral sequence reconstruction illuminates the evolutionary trajectory of nuclear-chloroplast interactions

    • Dating analysis establishes the timing of regulatory innovations (e.g., MDE1's role in atpE regulation evolved ~300 million years ago)

  • Systems biology integration:

    • Network analysis combining transcriptomic and proteomic data identifies coordinated regulation

    • Mathematical modeling predicts rate-limiting steps in assembly

    • Perturbation experiments validate model predictions

These approaches collectively provide mechanistic insights into the sophisticated intergenomic coordination required for ATP synthase assembly, with broader implications for understanding organellar biogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.