Recombinant Leptosira terrestris Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimations, please consult your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Pleurastrum terricola (Filamentous green alga) (Leptosira terrestris)
Target Names
cemA
Target Protein Sequence
MQEKIGLIPRSILRTLDRFRKQLFPNQETKTITLQEFQVSRQQMQVSVVTFLTLVLVPLG VNICGKTFLVKPFTQFLWNNYQTELFLNQFQAQRAFTEMQEIEDVLFFDSLIQNTNFCFN CSKAWNNYFVMQPSSYSSNSNFVIQKPDLANSQSKNSTCHNSKLILQKNVFEIYKFSENT DFFKDKMYGEQIHDGVKNSYNEFSSKASNALSNLEAPLYLGSEASLPPKLKNFDSRIFTA NQLNRDDKLIYMSLQEQPLVKKQNFLDKYQFAKHETQENVINKPEIYKIEGLLQTSEKDE MELRQDKLVALAIQYNEESIDAISNLIGDALTCITITFLFFGLKVQILILQSFLTESFYS LSNANRSLIIIIVTDLLVGYHSPQGWKLLTQLILQHYGFPETKLFILCFIGTFPVILDTI FKYWIFRHLNRISPTTVLTYHRMIE
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly contributes to efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Leptospira and why is it significant in research?

Leptospira is a genus of spirochete bacteria that causes leptospirosis, the most widespread zoonosis globally. It represents a significant emerging public health problem, particularly in urban centers of developing countries. Research interest stems from its worldwide distribution, high disease burden (approximately 500,000 cases reported yearly with 5-10% mortality), and the largely unknown mechanisms of pathogenesis that require further investigation .

What clinical manifestations characterize Leptospira infections?

Leptospira infections manifest across a spectrum of severity. Clinical presentations range from mild, flu-like illness to severe disease forms known as Weil's syndrome. The severe manifestation is characterized by jaundice, acute renal and hepatic failure, pulmonary distress, and hemorrhage, potentially leading to death. This diversity in clinical presentations makes leptospirosis diagnostically challenging and highlights the importance of understanding pathogenic mechanisms .

How are Leptospira species classified and what determines their pathogenicity?

Leptospira comprises both saprophytic (environmental) and pathogenic species. The genus includes several pathogenic species capable of causing disease with varying severity. While the search results don't provide exhaustive classification details, they indicate that pathogenic Leptospira strains like L. interrogans serovar Copenhageni can be isolated from patients during the acute phase of infection. Pathogenicity appears linked to specific surface-exposed proteins and sphingomyelinases absent in saprophytic leptospires .

Which recombinant Leptospira proteins show greatest diagnostic potential?

Among the recombinant antigens evaluated, LipL32 demonstrates the highest diagnostic utility for serodiagnosis. In IgG ELISA formats, rLipL32 showed superior sensitivity in both acute (56%) and convalescent (94%) phases of leptospirosis. Other recombinant proteins including OmpL1, LipL41, and Hsp58 exhibited lower sensitivities during the acute phase (16%, 24%, and 18% respectively) and convalescent phase (72%, 44%, and 32% respectively). Notably, patient sera did not significantly react with recombinant LipL36, consistent with its downregulation during infection .

How does the timing of sample collection affect serodiagnostic sensitivity?

The timing of sample collection significantly impacts diagnostic sensitivity, particularly for recombinant antigen-based assays. The research demonstrates that IgG reactivity against recombinant leptospiral proteins increases substantially from the acute to convalescent phase. For example, rLipL32 sensitivity rises from 56% in acute samples to 94% in convalescent samples. This temporal pattern of antibody development necessitates careful consideration of testing strategies, potentially requiring paired sera for definitive diagnosis in cases with negative acute-phase results .

What adhesion mechanisms enable Leptospira pathogenesis?

Leptospira employs multiple adhesion mechanisms to facilitate tissue colonization and infection. Pathogenic leptospires produce microbial surface components recognizing adhesive matrix molecules that mediate host colonization. They bind efficiently to various cell types including fibroblasts, monocytes/macrophages, endothelial cells, and kidney epithelial cells. This adhesion process involves multiple outer surface proteins, particularly LigA and LigB, which contain bacterial immunoglobulin-like domains. These proteins bind extracellular matrix components including elastin, tropoelastin, collagens I and IV, laminin, and fibronectin. The fibronectin-binding is modulated by calcium and is mediated by three specific motifs in LigB .

How does the leptospiral endostatin-like protein family contribute to pathogenesis?

The leptospiral endostatin-like protein (Len) family represents an important group of adhesion molecules. The characterized member Lsa24/LfhH/LenA binds laminin and has additional binding capabilities for complement factor H, factor H-related protein-1, fibrinogen, and fibronectin. Other members of this family (LenB, C, D, E, F) also bind fibronectin. Additional laminin-binding proteins identified include Lsa21, Lsa27, Lsa63, and a 36-kDa membrane protein. The surface-exposed nature of proteins like Lsa27 and Lsa63, combined with their reactivity with serum from leptospirosis patients, suggests potential roles in host adhesion and pathogenesis, though definitive experimental confirmation remains pending .

What environmental adaptation mechanisms do pathogenic Leptospira employ?

Pathogenic Leptospira species demonstrate sophisticated environmental adaptation mechanisms when transitioning from environmental to host conditions. Exposure to temperature and osmotic conditions mimicking the host environment triggers differential gene expression. In virulent strains, genes encoding virulence factors like ligA and ligB are upregulated at physiological osmolarity, while their expression is lost in culture-attenuated strains. Similarly, the putative virulence factor gene sph2 is induced, while the outer surface protein gene lipL36 is repressed at physiologic osmolarity. Interestingly, surface proteins are generally downregulated at physiological temperatures, potentially representing an immune evasion strategy. These adaptation mechanisms likely facilitate invasion and disease establishment in hosts .

How are recombinant Leptospira proteins expressed and purified?

Recombinant Leptospira proteins can be efficiently expressed and purified using established molecular biology techniques. The recommended approach involves:

  • Gene amplification by PCR from leptospiral genomic templates

  • Ligation of amplified genes into expression vectors (e.g., pRSET plasmid)

  • Expression as recombinant His-tagged fusion proteins

  • Purification by affinity chromatography

  • Quality assessment by immunoblotting using pooled sera from leptospirosis cases

This methodology has been successfully applied to produce recombinant versions of various leptospiral proteins including LipL32, OmpL1, LipL41, and Hsp58 .

What controls should be included when evaluating recombinant antigens for serodiagnosis?

Rigorous controls are essential when evaluating recombinant antigens for serodiagnosis. These should include:

  • Positive controls: Paired sera from confirmed leptospirosis cases (both acute and convalescent phases)

  • Negative controls: Sera from healthy individuals from both endemic and non-endemic regions

  • Cross-reactivity controls: Sera from patients with diseases that might be confused with leptospirosis or have similar symptoms (e.g., dengue, hepatitis)

  • Specificity controls: Proteins known to be unexpressed or downregulated during infection (e.g., LipL36)

Statistical analysis comparing absorbance values between these groups helps establish appropriate cutoff values for diagnostic specificity .

How can researchers identify novel surface-exposed proteins in Leptospira?

Identification of novel surface-exposed proteins in Leptospira requires a multi-technique approach. Researchers can employ:

  • In silico analysis to predict surface-exposed proteins

  • Triton X-114 fractionation to separate membrane proteins

  • Surface immunofluorescence to visualize exposed epitopes

  • Surface biotinylation to label accessible proteins

  • Membrane affinity tests to confirm membrane association

This combined approach has successfully identified proteins such as OmpL36, OmpL37, OmpL47, and OmpL54, though functional characterization of these proteins remains incomplete .

What methods are used to isolate and purify chloroplast envelope membranes?

Chloroplast envelope membrane isolation requires a sequential purification process with careful attention to maintaining membrane integrity. The established protocol involves:

  • Isolation of chloroplasts from plant tissue (e.g., spinach leaves)

  • Purification of chloroplasts by centrifugation in Percoll gradients

  • Lysis of chloroplasts in hypotonic medium

  • Separation of envelope membranes by centrifugation through step-sucrose gradients

  • Storage in liquid nitrogen (10 mg protein/ml in 10 mM MOPS-NaOH, pH 7.8) or lyophilization for subsequent treatments

This procedure yields highly purified envelope fractions devoid of contaminating membranes from thylakoids, mitochondria, endoplasmic reticulum, or other extraplastidial sources .

How can lipid-soluble components be removed from chloroplast envelope membranes?

Selective removal of lipid-soluble components from chloroplast envelope membranes can be achieved through pentane treatment. The detailed protocol involves:

  • Addition of chilled (0-5°C) distilled pentane to lyophilized envelope membranes (1 ml per 10 mg protein)

  • Vortexing in a glass tube for 5 minutes under argon at 0-5°C

  • Centrifugation at 1000 × g

  • Discarding the supernatant containing extracted lipids

  • Repeating the extraction four additional times

  • Removing residual pentane by evaporation under argon (1 hour at 0-5°C followed by 1 hour at 20°C)

  • Rehydration of envelope proteins in 1 mM MOPS-NaOH (pH 7.8)

This approach effectively depletes lipid-soluble components while preserving protein structures for subsequent analysis .

What techniques are employed to study redox activities in chloroplast envelope membranes?

Electron Paramagnetic Resonance (EPR) spectroscopy represents a powerful technique for investigating redox activities in chloroplast envelope membranes. The methodological approach includes:

  • Sample preparation: Envelope membranes (1.5-6 mg protein in 150 μl) placed in EPR quartz tubes and frozen in liquid nitrogen

  • Instrumentation: EPR spectrometer coupled to a calculator and equipped with a Gaussmeter and microwave-frequency counter for calibration

  • Temperature control: Cooling with liquid helium transfer system to variable temperatures starting from 4.2 K

  • Chemical reduction: Treatment with reducing agents such as dithionite (progressively added to achieve concentrations up to 5 mM) or 5-deazaflavin/oxalate, followed by incubation (3 minutes at 20°C) before freezing for analysis

This approach allows detailed characterization of semiquinone radicals and other redox-active components in the envelope membrane system .

How might techniques from membrane protein research apply to Leptospira outer membrane proteins?

Methods developed for chloroplast envelope membrane research could potentially be adapted for Leptospira outer membrane protein studies. Specifically, the pentane extraction technique for selective lipid removal might help isolate and purify Leptospira outer membrane proteins while preserving their structural integrity. Similarly, EPR spectroscopy could potentially characterize redox activities associated with leptospiral membrane proteins, though this application isn't directly addressed in the current research. Integration of these methodologies could advance understanding of how membrane protein structure influences leptospiral pathogenesis and host-pathogen interactions .

What challenges exist in recombinant protein expression for both research areas?

Both research areas face common challenges in recombinant protein expression, including:

  • Ensuring proper protein folding to maintain native structure and function

  • Achieving adequate expression levels for downstream applications

  • Confirming appropriate post-translational modifications

  • Validating biological activity of purified proteins

In leptospiral protein research, additional challenges include potential toxicity of virulence factors to expression hosts and accurately mimicking in vivo expression patterns induced by host environmental conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.