Recombinant Leptosira terrestris Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leptosira terrestris Photosystem I Assembly Protein Ycf4 (ycf4)

The Ycf4 protein is essential for the assembly of Photosystem I (PSI), a crucial component of photosynthesis, the energy-harvesting process in plants and cyanobacteria . Ycf is an acronym for hypothetical chloroplast open reading frame . Without Ycf4, photosynthesis becomes inefficient, which affects plant growth . Ycf4 is located in the thylakoid membrane of the chloroplast and is important for the light-dependent reactions of photosynthesis .

Function and Role of Ycf4 in Photosystem I Assembly

Ycf4 is a thylakoid protein required for the accumulation of PSI . It acts as a major mediator in the PSI-LHCI assembly process . The protein is firmly associated with the thylakoid membrane, presumably through a transmembrane domain .

Ycf4 works in conjunction with other proteins, such as Ycf3, to facilitate PSI assembly . Ycf3 and Ycf4 form modules that mediate PSI assembly . Ycf3, along with its interacting partner Y3IP1, primarily facilitates the assembly of reaction center subunits. In contrast, Ycf4 facilitates the integration of peripheral PSI subunits and light-harvesting complexes (LHCIs) into the PSI reaction center subcomplex .

Ycf4's Interactions

Ycf4 interacts with both Photosystem I and II proteins . The carboxyl terminus of YCF4 demonstrates a strong connection with LHCA1, LHCA2, LHCA3, LHCA4, and RRBC .

Experimental Evidence and Mutants

Studies using Chlamydomonas reinhardtii have shown that a mutant deficient in Ycf4 can still assemble the PSI complex, although at a reduced level . Introducing a targeted mutation into Mg-chelatase, the enzyme responsible for the first-committed step of chlorophyll biosynthesis, showed that restricting chlorophyll availability in a cyanobacterial strain lacking the Ycf48 assembly factor increased the severity of removing this protein .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Pleurastrum terricola (Filamentous green alga) (Leptosira terrestris)
Target Names
ycf4
Target Protein Sequence
MNAEIVVNNSNFSSNTPPFLKKQPEIRRYIIQGSRRFSNYWWAFIVCLGSIGFLLTGISS YFEFQNLLHLQNYFSFANEAQSSLNKVELPIILFFPQGLVMCFYGILGLFLSFYLWFSIF LNIGAGFNEIYIYTGETLKTENQYSKSINSNNLKANNWNSSKIKSNLKKFTKMKDTQTID YSSENELKNQLTNPNSAVCKFAKGGSEVGCWEQSALTPLPPTPLSHIRIFRWGFPGKNRK INLQYSIDQISAIKLEFLQGFNSKRTICLKLSDQREILLTGSPQGDWETFEQLEKQASEL AKFLKVNLEFSS
Uniprot No.

Target Background

Function

This protein appears essential for the assembly of the photosystem I complex.

Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid protein essential for the accumulation of photosystem I (PSI) in photosynthetic organisms. Research with Chlamydomonas reinhardtii has demonstrated that Ycf4 acts as a scaffold for PSI assembly, facilitating the organization of PSI subunits into functional complexes. Transformants lacking Ycf4 cannot grow photoautotrophically due to deficient photosystem I activity, as the PSI complex fails to accumulate stably in thylakoid membranes. The protein is not directly involved in the transcription of PSI genes or translation initiation of PSI mRNAs, but rather plays a critical role in the assembly process itself .

Where is Ycf4 localized in the cell and the genome?

The ycf4 gene is located in the Large Single Copy (LSC) region of the plastid genome, forming part of a gene cluster that includes psaI and accD genes upstream and cemA gene downstream—a region considered a local mutation hotspot . At the protein level, Ycf4 is localized to thylakoid membranes but is not stably associated with the mature PSI complex. Interestingly, Ycf4 accumulates to wild-type levels even in mutants lacking PSI, further supporting its role as an assembly factor rather than a structural component of the final complex .

What is the genomic organization of ycf4?

In Chlamydomonas reinhardtii, ycf4 and ycf3 are co-transcribed as part of the rps9–ycf4–ycf3–rps18 polycistronic transcriptional unit, producing RNAs of 8.0 kb and 3.0 kb that correspond to the entire unit and to rps9–ycf4–ycf3, respectively . This genomic arrangement varies across species, with significant reorganization observed in different lineages, particularly in the IRLC legumes where the region has undergone numerous rearrangements .

How can researchers isolate and characterize Ycf4-containing complexes?

Isolation of native Ycf4-containing complexes requires a multi-step purification strategy:

  • Affinity Purification: Tandem affinity purification (TAP) tagged Ycf4 can be used to purify the stable Ycf4-containing complex (>1500 kD) .

  • Sucrose Gradient Ultracentrifugation: Further purification can be achieved through density gradient separation.

  • Ion Exchange Chromatography: For final purification and separation of Ycf4 complexes.

  • Mass Spectrometry: Liquid chromatography-tandem mass spectrometry identifies associated proteins, including PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) and the opsin-related COP2 .

  • Electron Microscopy: Visualization reveals structures measuring approximately 285 × 185 Å, representing potential oligomeric states of the complex .

What expression systems are suitable for producing recombinant Ycf4?

Drawing from approaches used for other recombinant membrane proteins:

  • Prokaryotic Expression: Escherichia coli BL21 (DE3) hosts have been successfully used for expressing recombinant outer membrane proteins like OmpL1, LipL21, and LipL32 from Leptospira .

  • Optimization Considerations: Expression conditions must be carefully optimized for membrane proteins, including:

    • Induction temperature and duration

    • IPTG concentration

    • Inclusion of membrane-stabilizing agents

  • Solubilization Strategies: Appropriate detergents must be selected to maintain protein conformation during extraction from membranes.

How can the functionality of recombinant Ycf4 be assessed?

Functional assessment strategies include:

  • Complementation Studies: Introduction of recombinant Ycf4 into Ycf4-deficient mutants to assess restoration of photoautotrophic growth and PSI accumulation.

  • Protein-Protein Interaction Assays: Co-immunoprecipitation or pull-down assays to verify interaction with PSI subunits.

  • Assembly Monitoring: Pulse-chase protein labeling to track association of newly synthesized PSI polypeptides with Ycf4-containing complexes .

  • Spectroscopic Analysis: Measurement of PSI activity in complemented mutants versus controls.

How conserved is Ycf4 across different photosynthetic species?

Comparative analysis reveals that Ycf4 displays moderate sequence conservation across photosynthetic organisms. The deduced amino acid sequence of Ycf4 (197 residues in Chlamydomonas reinhardtii) shows 41-52% sequence identity with homologues from various algae, land plants, and cyanobacteria . This level of conservation suggests functional constraints on protein structure while allowing for species-specific adaptations.

What evidence exists for lineage-specific evolution of the ycf4 gene?

The ycf4 gene demonstrates remarkable evolutionary plasticity, particularly in certain plant lineages:

  • Length Variation: Among Lathyrus species with intact ycf4 genes, the length varies dramatically from 219 bp to 1023 bp .

  • Accelerated Evolution: The gene shows lineage-specific accelerated rates of evolution in the tribe Fabeae of the IRLC legumes.

  • Pseudogenization and Loss: Complete pseudogenization and gene loss have occurred in some lineages, indicating that alternative assembly mechanisms may have evolved .

  • Mutation Patterns: The ycf4 gene exhibits significantly higher variability in terms of both length and point mutations compared to neighboring genes like matK and rpl32 .

What are the implications of ycf4 variability for photosynthetic adaptation?

The high variability and even loss of ycf4 in some lineages raises important questions about photosynthetic adaptation:

  • Functional Redundancy: Other proteins may compensate for Ycf4 function in species where the gene has been lost.

  • Assembly Pathway Modifications: Alternative PSI assembly pathways may have evolved in different lineages.

  • Environmental Adaptation: Variations in Ycf4 sequence and structure may reflect adaptation to different light environments or photosynthetic requirements.

How does Ycf4 coordinate with other assembly factors during PSI biogenesis?

Research indicates a complex coordination network:

  • Ycf3 Cooperation: Both Ycf4 and Ycf3 are required for stable PSI accumulation but likely function at different stages of assembly .

  • COP2 Association: Almost all Ycf4 and COP2 in wild-type cells copurify, indicating intimate and exclusive association, though COP2 appears dispensable for PSI assembly .

  • Temporal Dynamics: Pulse-chase protein labeling reveals that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as pigment-containing subcomplexes .

What structural insights have been gained about Ycf4-containing complexes?

Structural characterization remains limited but has revealed:

  • Complex Size: The Ycf4-containing complex exceeds 1500 kD in size .

  • Dimensions: Electron microscopy shows particles measuring 285 × 185 Å .

  • Oligomeric States: The large size suggests several possible oligomeric arrangements.

  • Composition: The complex contains Ycf4, COP2, and PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF) .

How might site-directed mutagenesis approaches advance our understanding of Ycf4?

Strategic mutagenesis could identify:

  • Critical Residues: Conserved amino acids essential for Ycf4 function.

  • Interaction Domains: Regions responsible for binding PSI subunits.

  • Membrane Association: Domains required for thylakoid membrane integration.

  • Assembly Regulation: Residues involved in regulating assembly progression.

What lessons from recombinant Leptospira protein studies can be applied to Ycf4 research?

The extensive work on recombinant Leptospira outer membrane proteins offers valuable methodological insights:

  • Multi-Epitope Approaches: The construction of recombinant multi-epitope proteins (r-LMP) from selected immunodominant epitopes could be adapted for Ycf4 functional domain analysis .

  • Protein Engineering: The successful linking of different protein domains with flexible peptide linkers (GGGGSGGGGSGGGGS) allows independent folding of each region, a strategy applicable for creating chimeric Ycf4 constructs .

  • Expression Optimization: E. coli BL21 (DE3) hosts have been successfully used for expressing membrane proteins, providing a starting point for Ycf4 expression .

How can cross-reactivity assessment methods enhance Ycf4 research?

Methods for evaluating cross-reactivity between Leptospira serovars could be adapted for Ycf4 homologues:

  • ELISA-Based Comparison: Quantitative assessment of binding between Ycf4 variants and interaction partners .

  • Statistical Analysis: Application of unpaired tests to determine cross-reactivity using quantitative data .

  • Sensitivity and Specificity Determination: Rigorous evaluation of recombinant protein performance compared to native counterparts .

What purification challenges are specific to recombinant membrane proteins like Ycf4?

Membrane protein purification presents unique challenges:

  • Solubilization: Selection of appropriate detergents to extract Ycf4 from membranes without denaturation.

  • Protein Folding: Ensuring proper folding in the absence of thylakoid membrane environment.

  • Stability Maintenance: Preventing aggregation during concentration and storage.

  • Function Preservation: Maintaining interaction capabilities with assembly partners.

Table 1: Comparison of Key Properties of Ycf4 across Representative Species

SpeciesYcf4 Length (amino acids)Sequence Identity (%)Genomic ContextPhenotype of Ycf4 DeficiencyAssociated ProteinsReference
Chlamydomonas reinhardtii197Referencerps9–ycf4–ycf3–rps18 polycistronic unitUnable to grow photoautotrophically; PSI deficiencyCOP2, PsaA, PsaB, PsaC, PsaD, PsaE, PsaF
Land plants and algaeVariable41-52%Part of LSC regionPSI assembly defectsVariable
Lathyrus species (Group G)73 (219 bp)VariablePart of gene cluster with psaI, accD, cemANot determinedNot determined
Lathyrus species (Group E)341 (1023 bp)VariablePart of gene cluster with psaI, accD, cemANot determinedNot determined

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.