Recombinant Leptosira terrestris Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosystem II

The QB site, located in the D1 protein’s stromal loop (Ile219–Leu272), facilitates electron transport by reducing plastoquinone. Key structural features include:

  • QB Cavity: Formed by transmembrane helices IV and V, with residues like Ser264 and Phe265 forming hydrogen bonds to plastoquinone .

  • Protonation Pathways: His252 participates in QB protonation, essential for plastoquinol formation .

Studies on Chlamydomonas D1 mutants (e.g., Ala251 substitutions) reveal that bulkier amino acids increase QB dissociation constants, impairing electron transfer . The recombinant Leptosira protein provides a model to investigate these mechanisms without native PSII complexity .

Applications in PSII Assembly and Repair Research

This recombinant protein aids in studying:

  • Assembly Intermediates: Psb28, a chaperone, binds near the QB site during PSII assembly. Cross-linking data position Psb28 above cytochrome b559, stabilizing the RC47 intermediate .

  • D1 Turnover: LPA1/PratA and LQY1 assist D1 synthesis and repair. LPA1 interacts directly with D1, while LQY1’s disulfide isomerase activity aids CP43/CP47 folding .

Research Limitations and Future Directions

Current challenges include:

  • Instability: The protein requires glycerol (5–50%) for long-term storage, limiting experimental flexibility .

  • Unresolved Interactions: Psb28’s transient binding to D1 warrants further cross-linking or cryo-EM studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Pleurastrum terricola (Filamentous green alga) (Leptosira terrestris)
Target Names
psbA
Target Protein Sequence
MTAILERRETTSLWARFCEWVTSTENRLYIGWFGCLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAVVPTSNAIGLHFYPIWEAASLDEWLYNGGPYQLIVCHFF LGICAYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFIIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENQSANAGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVLDSQGRVLNTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How should recombinant Leptosira terrestris Photosystem Q(B) protein be stored and handled in laboratory settings?

Proper storage and handling of recombinant Leptosira terrestris Photosystem Q(B) protein is critical for maintaining its structural integrity and biological activity. The recommended storage protocol includes:

  • Store at -20°C to -80°C upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles (which can cause protein degradation)

  • For short-term storage (up to one week), working aliquots can be kept at 4°C

  • The lyophilized powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol (5-50% final concentration) is recommended for long-term storage

  • The standard storage buffer consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

For optimal handling, briefly centrifuge the vial before opening to bring the contents to the bottom. When preparing working solutions, avoid repeated freeze-thaw cycles as this significantly reduces protein activity .

What expression systems are most effective for producing recombinant Photosystem Q(B) protein?

Escherichia coli is the predominant expression system used for producing recombinant Leptosira terrestris Photosystem Q(B) protein. The commercially available recombinant protein is expressed in E. coli with an N-terminal His-tag to facilitate purification through affinity chromatography .

While E. coli is effective, researchers should consider several factors when selecting an expression system:

  • Protein folding considerations: Membrane proteins like Photosystem Q(B) often require specific folding machinery that may be limited in bacterial systems

  • Post-translational modifications: If studying functional aspects requiring specific modifications, eukaryotic expression systems might be more suitable

  • Scale requirements: E. coli offers advantages for high-yield production

  • Purification approach: The His-tag strategy allows for efficient single-step purification via metal affinity chromatography

The expression construct typically includes the full-length coding sequence (1-344 amino acids) of the Leptosira terrestris psbA gene (UniProt ID: A6YGB8) fused to an N-terminal His-tag .

What is the relationship between Photosystem Q(B) protein and photoinhibition processes?

The Photosystem Q(B) protein (D1) plays a central role in photoinhibition processes. Unlike Photosystem I (PSI), which has been less extensively studied, Photosystem II (PSII) and its D1 protein have been well-documented in photoinhibition research . Key points include:

  • The D1 protein is highly susceptible to light-induced damage, particularly when electron flow is disrupted

  • Over-supply of energy to PSII results in the generation of singlet oxygen (¹O₂) in the PSII reaction center, which damages the D1 protein

  • This damage leads to the suspension of PSII activity while D1 is replaced through a repair cycle

  • The light-induced inactivation of PSII serves a dual protective role:

    • It relieves excitation pressure on the remaining PSII complexes

    • It protects PSI from over-reduction

This relationship between PSII inactivation and PSI protection demonstrates the interconnected nature of the photosynthetic apparatus. The D1 protein's susceptibility to damage and subsequent repair represents an evolved mechanism to prevent more extensive damage to the photosynthetic machinery .

How do structural variations in recombinant versus native Photosystem Q(B) protein affect experimental outcomes?

The structural differences between recombinant and native Photosystem Q(B) protein can significantly impact experimental outcomes in several ways:

  • Membrane integration: The recombinant protein expressed in E. coli may lack proper membrane integration compared to the native protein in thylakoid membranes, potentially affecting structural studies and functional assays. Researchers should consider reconstitution into liposomes or nanodiscs to better mimic the native environment.

  • Post-translational modifications: Native Photosystem Q(B) protein undergoes various post-translational modifications in Leptosira terrestris that may be absent in the recombinant version from E. coli. These modifications can affect protein-protein interactions and electron transport capabilities.

  • Protein-cofactor interactions: The recombinant protein may not contain all the necessary cofactors (such as chlorophylls, carotenoids, and quinones) found in the native protein, which could alter its functional properties in experimental settings.

  • His-tag effects: The N-terminal His-tag in the recombinant protein (A6YGB8) can impact protein folding, oligomerization, and interactions with binding partners. Control experiments using tag-cleaved versions are recommended for critical binding studies .

  • Purity considerations: The recombinant protein has a purity greater than 90% as determined by SDS-PAGE, which means that trace contaminants could still influence certain highly sensitive assays .

To mitigate these differences, researchers should validate key findings using complementary approaches, such as in vivo studies or using membrane preparations from the native organism when possible.

What are the optimal experimental conditions for studying electron transport involving the Photosystem Q(B) protein?

Studying electron transport involving Photosystem Q(B) protein requires careful consideration of experimental conditions to maintain physiological relevance:

  • Buffer composition:

    • Tris/PBS-based buffers with pH 8.0 provide stability for the isolated protein

    • Addition of glycerol (5-50%) helps maintain protein integrity

    • Inclusion of specific electron donors and acceptors is essential for functional studies

  • Temperature considerations:

    • Most functional assays should be performed at 20-25°C to mimic physiological conditions

    • Temperature sensitivity studies should include ranges from 4-40°C to evaluate stability

  • Light conditions:

    • Controlled light exposure is critical as the protein is photosensitive

    • Use of monochromatic light sources at specific wavelengths (typically 680nm) for activation

    • Dark adaptation periods before experiments to reset the electron transport chain

  • Electron transport measurements:

    • Oxygen evolution measurements using Clark-type electrodes

    • Chlorophyll fluorescence analysis (particularly OJIP transients)

    • Absorption spectroscopy to track redox changes in the quinone acceptors

    • EPR spectroscopy for detailed analysis of electron transport intermediates

  • Inhibitor studies:

    • DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) specifically blocks electron transport at the Q(B) binding site

    • Comparison of inhibitor sensitivity between recombinant and native proteins provides functional validation

For reconstitution experiments, researchers should consider incorporating the protein into liposomes or nanodiscs with appropriate lipid compositions to better mimic the thylakoid membrane environment .

What methodologies are most effective for studying the interaction between Photosystem Q(B) protein and various electron acceptors?

Several methodologies are particularly effective for investigating interactions between Photosystem Q(B) protein and electron acceptors:

  • Biophysical techniques:

    • Surface Plasmon Resonance (SPR): Enables real-time monitoring of binding kinetics between the His-tagged recombinant protein and various quinones or artificial electron acceptors

    • Isothermal Titration Calorimetry (ITC): Provides thermodynamic parameters of binding interactions

    • Microscale Thermophoresis (MST): Allows measurement of interactions in solution with minimal sample consumption

  • Spectroscopic approaches:

    • Electron Paramagnetic Resonance (EPR): Detects formation of semiquinone radicals during electron transfer

    • Time-resolved fluorescence spectroscopy: Measures electron transfer rates from PSII to various acceptors

    • UV-Vis difference spectroscopy: Monitors changes in the redox state of bound quinones

  • Structural biology methods:

    • X-ray crystallography: With recombinant protein to visualize binding sites (though challenging with membrane proteins)

    • Cryo-electron microscopy: Increasingly used for membrane protein complexes to visualize electron acceptor binding

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of conformational change upon acceptor binding

  • Functional assays:

    • Oxygen evolution measurements: Quantifies electron transport efficiency with different acceptors

    • Chlorophyll fluorescence quenching: Assesses electron transport rates in reconstituted systems

    • Artificial electron acceptor assays: Using compounds like ferricyanide or dichlorophenolindophenol (DCPIP)

When designing these experiments, researchers should consider that the recombinant protein's stability is optimal in Tris/PBS buffer with 6% trehalose at pH 8.0, and appropriate controls should account for the presence of the His-tag, which might influence some interaction studies .

How does the amino acid sequence of Leptosira terrestris Photosystem Q(B) protein compare with homologous proteins in other photosynthetic organisms?

The amino acid sequence of Leptosira terrestris Photosystem Q(B) protein shows significant conservation with homologous proteins across diverse photosynthetic organisms, reflecting its fundamental role in photosynthesis. Key comparative observations include:

  • Domain conservation: The protein contains highly conserved transmembrane domains and functional regions critical for quinone binding and electron transport, particularly in the regions associated with the Q(B) binding pocket.

  • Species-specific variations: While the core functional domains are conserved, there are notable species-specific variations, particularly in loop regions and at the N-terminal region, which may reflect adaptations to different light environments or physiological conditions.

  • Evolutionary considerations: The psbA gene encoding this protein is considered among the most conserved photosynthetic genes, though Leptosira terrestris, as a filamentous green alga, shows some unique adaptations compared to higher plants.

  • Sequence identity metrics:

    • High similarity (>80%) with other green algae D1 proteins

    • Moderate similarity (60-70%) with higher plant homologs

    • Lower similarity (40-50%) with cyanobacterial counterparts

The 344-amino acid sequence of Leptosira terrestris Photosystem Q(B) protein (UniProt ID: A6YGB8) contains regions critical for interaction with other PSII subunits, binding of cofactors, and coordination of the water-splitting manganese cluster .

Understanding these sequence relationships is valuable for structural studies, functional predictions, and evolutionary analyses of photosynthetic systems across different organisms.

What approaches can be used to study the role of Photosystem Q(B) protein in photoprotection mechanisms?

Studying the role of Photosystem Q(B) protein in photoprotection mechanisms requires multifaceted approaches:

  • High-light stress experiments:

    • Expose reconstituted systems containing recombinant Photosystem Q(B) protein to varying light intensities

    • Monitor D1 protein degradation rates using immunoblotting

    • Analyze reactive oxygen species (ROS) production using fluorescent probes

    • Compare with native systems to identify protective mechanisms

  • Mutational analysis:

    • Generate site-directed mutations in key residues of the recombinant protein

    • Assess how these mutations affect susceptibility to photodamage

    • Focus on amino acids involved in binding plastoquinone or interacting with other PSII subunits

  • Integration with photoprotective mechanisms:

    • Study interactions with non-photochemical quenching (NPQ) components

    • Analyze the relationship between D1 turnover and protection of Photosystem I (PSI)

    • Investigate how D1 damage signals trigger protective responses

  • Comparative systems:

    • Compare the photoprotection role of D1 in Leptosira terrestris with other species

    • Analyze adaptations in the amino acid sequence that might confer different photoprotective properties

  • Recovery and repair studies:

    • Monitor the repair cycle of damaged D1 protein

    • Investigate factors affecting the synthesis and integration of new D1 protein

    • Study the proteases involved in degradation of damaged D1

Research has shown that light-induced inactivation of PSII serves a dual protective function by both relieving excitation pressure on remaining PSII complexes and protecting PSI from over-reduction. This indicates that D1 protein damage may be part of an evolved photoprotective strategy rather than simply a consequence of photodamage .

How can researchers effectively quantify and characterize protein-protein interactions involving Photosystem Q(B) protein?

Quantifying and characterizing protein-protein interactions involving Photosystem Q(B) protein requires specialized techniques that can accommodate the membrane-bound nature of this protein:

  • Co-immunoprecipitation (Co-IP):

    • Utilize the His-tag on the recombinant protein for pull-down assays

    • Identify interacting partners through mass spectrometry

    • Verify interactions using reciprocal Co-IP with antibodies against potential partners

  • Cross-linking mass spectrometry (XL-MS):

    • Apply chemical cross-linkers to stabilize transient interactions

    • Digest cross-linked complexes and analyze by mass spectrometry

    • Map interaction interfaces using computational approaches

  • Förster resonance energy transfer (FRET):

    • Generate fluorescently labeled versions of Photosystem Q(B) protein and potential partners

    • Measure energy transfer as an indication of proximity

    • Perform acceptor photobleaching FRET for quantitative analysis

  • Bimolecular fluorescence complementation (BiFC):

    • Split fluorescent proteins fused to Photosystem Q(B) and potential interactors

    • Reconstitution of fluorescence indicates interaction

    • Especially useful for in vivo studies in model photosynthetic organisms

  • Quantitative binding assays:

    • Surface plasmon resonance (SPR) with immobilized His-tagged protein

    • Microscale thermophoresis (MST) for solution-based measurements

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Analytical ultracentrifugation:

    • Characterize complex formation in solution

    • Determine stoichiometry and binding constants

    • Assess the impact of different buffer conditions on interactions

When designing these experiments, researchers should consider reconstituting the Photosystem Q(B) protein into membrane mimetics such as nanodiscs or liposomes to provide a more native-like environment for interaction studies. Additionally, control experiments using the His-tag alone or denatured protein are essential to distinguish specific from non-specific interactions .

What are the key considerations for designing functional assays with recombinant Photosystem Q(B) protein?

Designing robust functional assays with recombinant Photosystem Q(B) protein requires careful attention to several critical factors:

  • Protein reconstitution strategies:

    • Incorporate the protein into liposomes or nanodiscs to mimic the native membrane environment

    • Optimize lipid composition to match thylakoid membrane characteristics

    • Verify proper orientation of the protein in the membrane system

  • Cofactor requirements:

    • Ensure appropriate addition of essential cofactors (chlorophylls, carotenoids, quinones)

    • Verify cofactor binding through absorption spectroscopy

    • Consider the impact of the His-tag on cofactor binding

  • Electron transport chain components:

    • Include necessary redox partners for complete electron transport studies

    • Use artificial electron donors and acceptors when studying specific segments of the transport chain

    • Control the redox state of components to establish defined starting conditions

  • Detection methods optimization:

    • For fluorescence-based assays: optimize excitation/emission settings and consider inner filter effects

    • For oxygen evolution measurements: calibrate electrodes and control for background oxygen consumption

    • For spectroscopic methods: establish appropriate baselines and control for light scattering

  • Assay validation approaches:

    • Use known inhibitors (e.g., DCMU) as positive controls

    • Compare results with native thylakoid preparations when possible

    • Include protein-free controls to account for non-specific effects

  • Data analysis considerations:

    • Apply appropriate kinetic models for electron transport data

    • Consider cooperativity in binding and functional studies

    • Account for the potential influence of protein aggregation on functional parameters

The recombinant protein's stability in Tris/PBS buffer with 6% trehalose at pH 8.0 should be maintained throughout functional studies, and the addition of glycerol (5-50%) may be necessary for certain assays to maintain protein stability .

How can researchers effectively troubleshoot common challenges in experiments involving Photosystem Q(B) protein?

Researchers working with Photosystem Q(B) protein frequently encounter challenges that require systematic troubleshooting approaches:

  • Protein aggregation issues:

    • Problem: The hydrophobic nature of Photosystem Q(B) protein can lead to aggregation

    • Solutions:

      • Add mild detergents at concentrations below their critical micelle concentration

      • Optimize buffer conditions (pH 8.0 is optimal for stability)

      • Maintain glycerol (5-50%) in storage and working solutions

      • Use freshly prepared protein and avoid repeated freeze-thaw cycles

  • Loss of functionality during experiments:

    • Problem: Decrease in electron transport activity over time

    • Solutions:

      • Conduct experiments under dim light or green light to minimize photodamage

      • Add antioxidants to reaction mixtures to scavenge reactive oxygen species

      • Optimize protein-to-lipid ratios in reconstitution experiments

      • Store working aliquots at 4°C for no more than one week

  • Inconsistent reconstitution results:

    • Problem: Variable incorporation into membrane mimetics

    • Solutions:

      • Standardize reconstitution protocols using consistent protein-to-lipid ratios

      • Verify protein orientation using protease protection assays

      • Characterize proteoliposomes using dynamic light scattering

      • Use density gradient centrifugation to purify properly reconstituted systems

  • Non-specific binding in interaction studies:

    • Problem: False positives in binding assays

    • Solutions:

      • Include appropriate blocking agents (BSA, non-ionic detergents)

      • Use competitive binding assays to confirm specificity

      • Perform control experiments with denatured protein

      • Consider His-tag influence and potentially cleave the tag for critical experiments

  • Difficulties in data interpretation:

    • Problem: Complex kinetic patterns in functional assays

    • Solutions:

      • Develop appropriate mathematical models that account for cooperativity

      • Use multiple complementary techniques to cross-validate findings

      • Compare with published data on similar systems

      • Decompose complex reactions into simpler components for analysis

Maintaining detailed records of experimental conditions, protein batch information, and exact buffer compositions is essential for troubleshooting and ensuring reproducibility in experiments with this challenging but important photosynthetic protein .

What emerging technologies offer new insights into Photosystem Q(B) protein function and structure?

Several cutting-edge technologies are revolutionizing research on Photosystem Q(B) protein:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy (cryo-EM): Allows visualization of membrane proteins without crystallization, potentially revealing dynamic states of the Q(B) protein

    • Micro-electron diffraction (microED): Enables structure determination from nanocrystals, particularly valuable for membrane proteins

    • Serial femtosecond crystallography: Uses X-ray free-electron lasers to capture structural snapshots during electron transport

  • Single-molecule techniques:

    • Single-molecule FRET: Measures distances between labeled sites during conformational changes

    • Atomic force microscopy (AFM): Provides topographical information and mechanical properties of reconstituted systems

    • Single-molecule force spectroscopy: Investigates protein stability and unfolding pathways

  • Advanced spectroscopic methods:

    • 2D electronic spectroscopy: Reveals energy transfer pathways with femtosecond resolution

    • Time-resolved X-ray absorption spectroscopy: Tracks electron movements through the protein

    • Ultrafast transient absorption spectroscopy: Monitors electron transfer events in real-time

  • Computational approaches:

    • Molecular dynamics simulations: Models protein behavior in membrane environments

    • Quantum mechanics/molecular mechanics (QM/MM): Calculates electron transfer energetics

    • Machine learning algorithms: Predicts functional impacts of sequence variations

  • Synthetic biology tools:

    • Bioorthogonal chemistry: Introduces non-canonical amino acids for site-specific modification

    • Nanodiscs with controlled lipid composition: Creates defined membrane environments

    • Optogenetic control elements: Enables light-triggered protein interactions

These emerging technologies promise to reveal previously inaccessible aspects of Photosystem Q(B) protein function, particularly regarding the precise mechanisms of electron transfer, protein dynamics during photodamage and repair, and interactions with other components of the photosynthetic apparatus .

How might understanding of Photosystem Q(B) protein contribute to artificial photosynthesis research?

Understanding the Photosystem Q(B) protein offers valuable insights for artificial photosynthesis research in several key areas:

  • Biomimetic catalyst design:

    • The Q(B) binding site architecture provides a template for designing synthetic electron acceptors

    • Understanding how the protein stabilizes semiquinone intermediates can inform development of artificial redox catalysts

    • The protein's oxygen tolerance mechanisms could improve stability of synthetic systems

  • Electron transport optimization:

    • Elucidating the factors controlling electron transfer rates in natural systems

    • Identifying key amino acid residues that facilitate efficient charge separation

    • Understanding how protein environment tunes redox potentials of electron carriers

  • Photoprotection strategies:

    • The D1 protein's role in managing photodamage suggests design principles for robust artificial systems

    • Understanding how photosynthetic systems balance efficiency with photoprotection

    • Developing self-repair mechanisms inspired by the D1 turnover cycle

  • System integration approaches:

    • Learning how natural systems couple electron transport to proton translocation

    • Understanding the spatial organization of electron transport components

    • Identifying minimal components needed for efficient light energy conversion

  • Performance under fluctuating conditions:

    • Understanding how natural systems adapt to changing light intensities

    • Developing regulatory mechanisms inspired by photosynthetic control

    • Creating artificial systems with feedback regulation to prevent photodamage

Practical applications in artificial photosynthesis could include development of bio-inspired solar fuel production systems, photoelectrochemical cells with improved efficiency and stability, and novel solar energy conversion technologies that incorporate key features of the natural photosynthetic apparatus.

What are the most significant research gaps in our understanding of Photosystem Q(B) protein?

Despite decades of research, several critical knowledge gaps remain in our understanding of Photosystem Q(B) protein:

  • Dynamic structural changes:

    • How the protein structure changes during the electron transport cycle

    • Conformational dynamics associated with quinone binding and release

    • Structural adaptations during environmental stress responses

  • Protein-lipid interactions:

    • Specific lipid requirements for optimal function

    • How membrane composition affects electron transport efficiency

    • Role of lipid-protein interactions in photoprotection

  • Species-specific adaptations:

    • Functional significance of sequence variations in Leptosira terrestris compared to other organisms

    • Evolutionary adaptations to different light environments

    • How structural differences correlate with ecological niches

  • Regulatory mechanisms:

    • Post-translational modifications affecting protein function

    • Interaction with regulatory proteins during stress responses

    • Signaling pathways triggered by D1 damage

  • Repair and turnover processes:

    • Molecular recognition events that trigger D1 degradation

    • Assembly process for newly synthesized D1 protein

    • Integration of cofactors during the repair cycle

  • Integration with other photosynthetic components:

    • Communication between Photosystems I and II

    • Coordination of electron and proton transfer

    • Role in supercomplexes and dynamic reorganization

Addressing these knowledge gaps will require interdisciplinary approaches combining structural biology, biochemistry, biophysics, and systems biology. The recombinant Leptosira terrestris Photosystem Q(B) protein offers a valuable tool for investigating these questions in controlled experimental systems .

How can comparative studies of Photosystem Q(B) protein across different species advance our understanding of photosynthetic evolution?

Comparative studies of Photosystem Q(B) protein across diverse photosynthetic organisms provide unique insights into photosynthetic evolution:

  • Evolutionary adaptation mechanisms:

    • Identification of conserved regions essential for core function versus variable regions representing environmental adaptations

    • Correlation of sequence variations with habitat-specific light conditions or stress tolerance

    • Reconstruction of ancestral sequences to understand evolutionary trajectories

  • Functional diversity analysis:

    • Comparison of electron transport efficiencies across taxonomic groups

    • Differential susceptibility to photoinhibition and repair mechanisms

    • Species-specific regulatory networks controlling D1 turnover

  • Structural comparative approaches:

    • Mapping structural differences onto phylogenetic trees

    • Identifying co-evolving residues that maintain functional interactions

    • Understanding how structural variations influence quinone binding and electron transfer rates

  • Cross-species experimental strategies:

    • Heterologous expression of D1 variants from different species

    • Creation of chimeric proteins to identify functional domains

    • Site-directed mutagenesis to introduce species-specific residues

  • Ecological and physiological correlations:

    • Relating D1 protein characteristics to ecological niches

    • Understanding adaptations to extreme environments (high light, temperature, etc.)

    • Correlating D1 protein evolution with photosynthetic efficiency in different habitats

Studies of Leptosira terrestris Photosystem Q(B) protein, representing a filamentous green alga, provide an important evolutionary perspective between unicellular algae and land plants. The specific adaptations in this protein may reveal how photosynthetic organisms adapted to different light environments during the transition from aquatic to terrestrial habitats .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.