Recombinant Leptosphaeria maculans Bifunctional lycopene cyclase/phytoene synthase (Lema_P114090.1)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Lema_P114090.1 is a recombinant protein derived from Leptosphaeria maculans, a fungal pathogen of Brassica crops. The protein contains two functional domains:

  • Lycopene cyclase: Catalyzes the cyclization of lycopene to β-carotene (EC 5.5.1.19).

  • Phytoene synthase: Converts geranylgeranyl pyrophosphate (GGPP) to phytoene (EC 2.5.1.32).

This bifunctional enzyme is critical for carotenoid biosynthesis, enabling sequential conversion of intermediates into β-carotene. The protein is expressed with an N-terminal His-tag for purification and is available in lyophilized form .

Sequence and Domain Organization

PropertyDetail
Protein LengthFull-length (1-581 amino acids)
UniProt IDE4ZUB5
Gene NameLema_P114090.1
AA SequenceMGFDYALVHLKYTIPPAVLLTLLYRPLLTKIDVYKVAFLVTIAVVATIPWDSYLIRNRIW SYPDHVIIGPTLFDIPLEEVFFFVVQTYNTSLLYLVLSKPTFQPVYLCTERDELHGSWRL KRLIGQAILLGAIAWGWFCVRERGLGTYTGLILIWAGPFLLLLWSLAYQFIIGLPFTNTL LPIVLPTLYLWIVDTLALRRGTWVISPGTKFGVHLWDGLEIEEALFFLLTNVLIVFGQLA FDNALAVLYAFPHLFPDPSLLPSPATLIRSLLTSCAQYDEARLTGFREAVSRLKRKSRSF YLASSTFQGPLRMDLLLLYSFCRVADDLVDNAATTEEARQWIAKLHKFLDNVYRKDVVCS SVTDQVRKEFPLDTHSALLQLPCCKLSAEPLRDLLRGFEMDLEFNSTSPIQSTEDLVLYS ERVAGTVAQMCIQLIFHLYPSSLTAEKRHKVVAAGNSMGVALQYVNIARDIGVDAKIGRV YLPTDWLSEVGLNCDTVLKDPKDPRIEALRGRLLDDAFSFYEEAKLAIAQLPIEAQGPIR VAVESYMEIGRTLKQDGFIVKAGRATVPKWRRVLVAWRTLN

Enzymatic Activities

EnzymeSubstrateProductBiological Role
Phytoene SynthaseGeranylgeranyl pyrophosphate (GGPP)PhytoeneFirst committed step in carotenoid biosynthesis
Lycopene CyclaseLycopeneβ-CaroteneFinal cyclization step for β-carotene production

The bifunctional design enhances metabolic efficiency by linking phytoene synthesis to cyclization, a strategy observed in other fungi like Phycomyces blakesleeanus .

Biochemical Properties and Handling

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL) with 5-50% glycerol (recommended 50%)
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles

Note: Repeated freezing/thawing is discouraged. Working aliquots can be stored at 4°C for ≤1 week .

Functional Analogs in Other Organisms

Studies on homologous proteins (e.g., Phycomyces carRA) demonstrate:

  • Domain-specific mutations:

    • Lycopene cyclase domain: Red mutants accumulate lycopene due to cyclase inactivity .

    • Phytoene synthase domain: White mutants fail to produce carotenoids .

  • Regulatory Role: The enzyme modulates pathway activity in response to environmental stimuli .

Pathway Integration

In Leptosphaeria maculans, this enzyme operates alongside:

  1. Phytoene dehydrogenase (CrtI): Converts phytoene to lycopene via dehydrogenation .

  2. Carotenoid regulatory proteins: Control flux through the pathway .

Industrial Relevance

While direct applications for Lema_P114090.1 are not detailed in literature, its bifunctional nature suggests potential use in:

  • Microbial carotenoid production: Engineering β-carotene synthesis in E. coli or yeast.

  • Plant pathogen research: Studying carotenoid metabolism in L. maculans pathogenicity .

Comparative Analysis with Related Proteins

OrganismEnzymeDomainsKey Feature
Leptosphaeria maculansLema_P114090.1Lycopene cyclase + Phytoene synthaseRecombinant His-tagged protein
Phycomyces blakesleeanusCarRALycopene cyclase + Phytoene synthaseRegulates pathway activity
Xanthophyllomyces dendrorhousCrtYBLycopene cyclase + Phytoene synthaseNatural fusion enhances enzyme stability

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Lema_P114090.1; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
full length protein
Species
Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam)
Target Names
Lema_P114090.1
Target Protein Sequence
MGFDYALVHLKYTIPPAVLLTLLYRPLLTKIDVYKVAFLVTIAVVATIPWDSYLIRNRIW SYPDHVIIGPTLFDIPLEEVFFFVVQTYNTSLLYLVLSKPTFQPVYLCTERDELHGSWRL KRLIGQAILLGAIAWGWFCVRERGLGTYTGLILIWAGPFLLLLWSLAYQFIIGLPFTNTL LPIVLPTLYLWIVDTLALRRGTWVISPGTKFGVHLWDGLEIEEALFFLLTNVLIVFGQLA FDNALAVLYAFPHLFPDPSLLPSPATLIRSLLTSCAQYDEARLTGFREAVSRLKRKSRSF YLASSTFQGPLRMDLLLLYSFCRVADDLVDNAATTEEARQWIAKLHKFLDNVYRKDVVCS SVTDQVRKEFPLDTHSALLQLPCCKLSAEPLRDLLRGFEMDLEFNSTSPIQSTEDLVLYS ERVAGTVAQMCIQLIFHLYPSSLTAEKRHKVVAAGNSMGVALQYVNIARDIGVDAKIGRV YLPTDWLSEVGLNCDTVLKDPKDPRIEALRGRLLDDAFSFYEEAKLAIAQLPIEAQGPIR VAVESYMEIGRTLKQDGFIVKAGRATVPKWRRVLVAWRTLN
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the conversion of geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Database Links

STRING: 5022.CBX94994

Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Lema_P114090.1 and what are its primary functions?

Lema_P114090.1 is a bifunctional enzyme from the fungal plant pathogen Leptosphaeria maculans that contains two enzymatic activities: lycopene cyclase and phytoene synthase . These activities are typically encoded by separate genes in non-fungal organisms, making this bifunctional arrangement particularly interesting from an evolutionary perspective . The full-length protein consists of 581 amino acids and can be expressed as a recombinant protein with affinity tags such as His-tags to facilitate purification . The protein plays a critical role in carotenoid biosynthesis, with the lycopene cyclase activity converting linear lycopene to cyclic carotenoids and the phytoene synthase activity catalyzing the condensation of geranylgeranyl diphosphate molecules to form phytoene.

How is Lema_P114090.1 structurally organized to support its dual functions?

Based on studies of similar bifunctional enzymes in fungi such as Mucor circinelloides, Lema_P114090.1 likely contains two distinct functional domains . The N-terminal domain (R domain) possesses lycopene cyclase activity, while the C-terminal domain (P domain) is responsible for phytoene synthase activity . Research on homologous proteins indicates that the R domain can maintain functionality independently of the P domain, whereas the P domain requires proper R domain conformation to function correctly . This structural interdependence suggests that the domains have co-evolved to optimize the sequential catalytic activities in carotenoid biosynthesis.

What expression systems are most effective for producing recombinant Lema_P114090.1?

Escherichia coli is the preferred expression system for Lema_P114090.1 due to its simplicity, rapid growth, and established protocols for recombinant protein production . For optimal expression, the following methodology is recommended:

  • Clone the full-length Lema_P114090.1 gene (coding for amino acids 1-581) into an expression vector containing an appropriate promoter (typically T7 or tac) and an N-terminal or C-terminal His-tag for purification.

  • Transform the construct into an E. coli expression strain such as BL21(DE3), Rosetta, or JM109, which are designed to enhance protein expression .

  • Optimize expression conditions through a systematic screening of different media formulations, as protein yield is highly dependent on media composition . The table below summarizes common media options:

Media TypeCompositionTypical Application
LB (Miller) BrothTraditional, non-bufferedInitial screening
Glucose M9YDefined minimal medium with supplementsScalable expression
Hyper BrothRich, buffered mediumHigh-density cultures
Power BrothEnhanced, buffered mediumImproved protein yield
Superior BrothRich, buffered mediumAlternative to Hyper Broth
Turbo BrothHigh-nutrient mediumRapid expression
  • Conduct expression trials with different induction parameters (IPTG concentration, temperature, and duration) to optimize functional protein production .

What purification strategy yields the highest purity and activity for Lema_P114090.1?

A multi-step purification process is recommended for obtaining highly pure and active Lema_P114090.1:

  • Immobilized Metal Affinity Chromatography (IMAC): Utilize the His-tag on the recombinant protein for initial purification using Ni-NTA or Co-NTA resins . Optimize binding conditions (buffer composition, imidazole concentration) to enhance selectivity.

  • Size Exclusion Chromatography (SEC): Further purify the protein based on molecular size to separate monomeric forms from aggregates and remove remaining contaminants.

  • Ion Exchange Chromatography (optional): Depending on the isoelectric point of Lema_P114090.1, incorporate an ion exchange step (typically anion exchange) to remove closely related contaminants.

  • Activity Preservation: Throughout purification, maintain reducing conditions (typically using DTT or β-mercaptoethanol) and include glycerol (10-20%) in storage buffers to preserve the dual enzymatic activities.

  • Purity Assessment: Confirm protein purity using SDS-PAGE analysis and Western blotting with antibodies specific to the His-tag or to Lema_P114090.1 epitopes.

How can the individual domains of Lema_P114090.1 be characterized independently?

To characterize the individual domains of Lema_P114090.1, the following methodological approach is recommended:

  • Domain Prediction and Boundary Identification:

    • Perform sequence alignment with homologous bifunctional enzymes like the carRP protein from Mucor circinelloides

    • Use protein domain prediction software (SMART, Pfam, InterPro) to identify potential domain boundaries

    • Design truncated constructs that express either the N-terminal (R) domain or the C-terminal (P) domain

  • Domain-Specific Expression:

    • Clone domain-specific sequences into expression vectors

    • Express domains individually in E. coli using optimized media conditions

    • Purify domains using affinity chromatography and assess folding using circular dichroism spectroscopy

  • Functional Assays for Individual Domains:

    • For the R domain (lycopene cyclase): Develop assays using lycopene as substrate and measure the formation of cyclic carotenoids by HPLC

    • For the P domain (phytoene synthase): Establish assays using geranylgeranyl diphosphate as substrate and detect phytoene formation

    • Compare activities of isolated domains with the full-length protein to assess interdependence

  • Structural Analysis:

    • Perform limited proteolysis to identify stable domain fragments

    • Use X-ray crystallography or cryo-EM to determine the three-dimensional structures of individual domains

    • Employ molecular dynamics simulations to understand domain interactions

What experimental evidence supports the functional interdependence of the two catalytic domains?

Studies on homologous bifunctional enzymes provide insights into domain interdependence that can guide research on Lema_P114090.1 . For this protein, researchers should consider:

  • Activity Assays with Domain Mutations:

    • Introduce site-directed mutations in conserved residues of each domain

    • Assess effects of R domain mutations on P domain activity and vice versa

    • Measure both lycopene cyclase and phytoene synthase activities in each mutant

  • Domain Complementation Studies:

    • Express R and P domains separately and reconstitute in vitro

    • Perform complementation experiments in E. coli co-expressing both domains

    • Compare activities with those of the native bifunctional enzyme

  • Structural Investigations:

    • Use FRET or other proximity assays to detect domain interactions

    • Perform crosslinking experiments to identify interacting residues between domains

    • Develop computational models of domain-domain interfaces

Based on studies of similar enzymes, we would expect to find that the R domain (lycopene cyclase) can function independently when properly folded, while the P domain (phytoene synthase) requires proper R domain conformation for activity . This asymmetric dependency suggests a structural basis for the evolution of this bifunctional arrangement.

What assay methods are most reliable for measuring the dual activities of Lema_P114090.1?

Developing robust assays for both enzymatic activities is essential for characterizing Lema_P114090.1. The following methodological approaches are recommended:

  • Lycopene Cyclase Activity Assay:

    • Substrate Preparation: Purify lycopene from natural sources or commercial suppliers

    • Reaction Conditions: Optimize buffer composition, pH (typically 7.5-8.0), temperature, and cofactor requirements

    • Detection Methods: Use HPLC with photodiode array detection to monitor the conversion of lycopene to β-carotene and other cyclic products

    • Quantification: Develop standard curves using authentic standards of β-carotene and other cyclization products

  • Phytoene Synthase Activity Assay:

    • Substrate Preparation: Synthesize or purchase geranylgeranyl diphosphate

    • Reaction Conditions: Determine optimal buffer, pH, temperature, and divalent cation requirements (typically Mg2+ or Mn2+)

    • Detection Methods: Employ HPLC with UV detection at 286 nm (absorption maximum for phytoene)

    • Alternative Detection: Consider using radiolabeled substrates and thin-layer chromatography for increased sensitivity

  • Coupled Assays for Full Pathway Analysis:

    • Design assays that provide geranylgeranyl diphosphate as the starting substrate

    • Include additional enzymes like phytoene desaturase (if available) to convert phytoene to colored carotenoids for easier detection

    • Monitor the formation of final products using spectrophotometric methods

How do environmental factors affect the enzymatic activities of Lema_P114090.1?

Understanding environmental influences on enzyme activity is crucial for both basic characterization and applied research. Investigate the following factors:

  • Temperature and pH Profiling:

    • Determine temperature optima for both enzymatic activities separately

    • Establish pH-activity profiles for each function

    • Assess whether optimal conditions differ between the two activities

  • Light Regulation:

    • Based on findings from related systems, test the effects of blue light on enzyme activity

    • Design experiments with controlled light exposure during expression and/or enzyme assays

    • Investigate potential light-sensing domains or motifs within the protein sequence

  • Redox Sensitivity:

    • Examine the effects of oxidizing and reducing conditions on enzyme stability and activity

    • Identify potential redox-sensitive cysteine residues through sequence analysis

    • Test the impact of various reducing agents (DTT, β-mercaptoethanol, glutathione) on activity preservation

  • Divalent Cation Requirements:

    • Screen different metal ions (Mg2+, Mn2+, Zn2+, Ca2+) for their effects on both enzymatic activities

    • Determine optimal concentrations for each cation

    • Investigate potential metal binding sites through sequence analysis and mutagenesis

How can structural biology approaches enhance our understanding of Lema_P114090.1?

Advanced structural characterization of Lema_P114090.1 can provide insights into its bifunctional nature and evolutionary development:

What evolutionary insights can be gained from comparative analysis of Lema_P114090.1 with related enzymes?

Evolutionary analysis can reveal how this bifunctional enzyme emerged and provide insights into its structural and functional optimization:

  • Phylogenetic Analysis:

    • Construct comprehensive phylogenetic trees including both bifunctional enzymes and their monofunctional counterparts

    • Analyze the distribution of bifunctional arrangements across fungal lineages

    • Identify potential gene fusion events and estimate their timing

  • Sequence Conservation Patterns:

    • Perform detailed sequence alignments to identify conserved motifs within each domain

    • Compare conservation patterns between bifunctional and monofunctional enzymes

    • Identify residues potentially involved in domain communication and functional coupling

  • Structural Comparison:

    • If structural data is available, compare the domain architectures of bifunctional and monofunctional enzymes

    • Analyze domain interfaces to understand the structural basis for functional coupling

    • Identify potential adaptations that enable the bifunctional arrangement

  • Functional Evolution:

    • Compare kinetic parameters between bifunctional enzymes and their monofunctional counterparts

    • Investigate whether the bifunctional arrangement offers catalytic advantages

    • Explore the potential regulatory benefits of having both activities in a single protein

What media composition strategies can maximize the yield of functional Lema_P114090.1?

Optimizing media composition is a critical step in achieving high yields of functional Lema_P114090.1:

  • Systematic Media Screening:

    • Test multiple media formulations as described in the following table :

Media TypeComposition HighlightsExpected BenefitsConsiderations
LB (Miller)Tryptone, yeast extract, NaClStandard reference mediumUnbuffered; limited for high-density cultures
Glucose M9YMinimal medium with glucose, yeast extractDefined composition; scalableMay yield lower biomass
Hyper BrothRich, complex, bufferedHigh biomass yieldMay not maximize specific protein production
Power BrothEnhanced nutrient formulationImproved recombinant protein yieldComposition optimized for expression
Superior BrothAlternative rich formulationDifferent nutrient balanceMay favor specific proteins
Turbo BrothHigh-nutrient, specializedRapid growth and expressionPotentially higher cost
  • Design of Experiment (DOE) Approach:

    • Implement factorial design experiments to test combinations of media components

    • Analyze interactions between key variables (carbon source, nitrogen source, trace elements)

    • Optimize component concentrations using response surface methodology

  • Feed Strategies for High-Density Cultures:

    • Develop fed-batch protocols with controlled nutrient addition

    • Test different carbon sources for feeding (glucose, glycerol)

    • Monitor dissolved oxygen and adjust feed rates accordingly

  • Media Supplementation:

    • Test additives that might stabilize the protein (osmolytes, chaperone inducers)

    • Add precursors for cofactors or prosthetic groups if required

    • Include protease inhibitors if degradation is observed

How can expression conditions be optimized to enhance the solubility and activity of Lema_P114090.1?

Beyond media composition, several factors can influence the production of soluble, active Lema_P114090.1:

  • Temperature Optimization:

    • Test expression at various temperatures (37°C, 30°C, 25°C, 18°C)

    • Consider temperature shifts after induction to balance growth and protein folding

    • Evaluate both protein yield and specific activity at each temperature

  • Induction Parameters:

    • Optimize inducer concentration (typically IPTG for T7-based systems)

    • Test different induction times based on culture density (early, mid, or late log phase)

    • Evaluate the duration of expression post-induction (3h, 6h, overnight)

  • Co-expression Strategies:

    • Co-express molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) to assist protein folding

    • Consider co-expressing protein disulfide isomerase for correct disulfide bond formation if relevant

    • Test fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

  • Oxygen Availability:

    • Optimize culture volume-to-flask volume ratio for proper aeration

    • Consider baffled flasks to enhance oxygen transfer

    • Monitor the impact of dissolved oxygen levels on protein quality and activity

What approaches can resolve contradictions in experimental data when characterizing Lema_P114090.1?

Researchers often encounter contradictory results when characterizing complex bifunctional enzymes. The following strategies can help resolve such discrepancies:

  • Protein Quality Assessment:

    • Implement rigorous quality control procedures to ensure protein homogeneity

    • Use multiple biophysical techniques (SEC-MALS, DLS, native PAGE) to confirm oligomeric state

    • Check for potential degradation or post-translational modifications by mass spectrometry

  • Methodological Variables:

    • Systematically examine differences in experimental conditions between contradictory studies

    • Test the effects of buffer components, pH, temperature, and cofactors on results

    • Implement standardized protocols with detailed documentation of all parameters

  • Multifaceted Approach:

    • Apply complementary techniques to measure the same parameter

    • For activity measurements, use both spectrophotometric and chromatographic methods

    • For structural characterization, combine solution-based techniques with crystallography

  • Statistical Robustness:

    • Increase the number of biological and technical replicates

    • Apply appropriate statistical tests to determine significance of observed differences

    • Consider Bayesian approaches for integrating data from multiple experiments

How can Lema_P114090.1 be utilized as a model system for studying bifunctional enzymes?

Lema_P114090.1 offers several advantages as a model system for investigating fundamental aspects of bifunctional enzymes:

  • Domain Communication Studies:

    • Investigate allosteric mechanisms between domains using mutagenesis and kinetic studies

    • Design domain-swapping experiments with homologous bifunctional enzymes

    • Explore the effects of flexible linker modifications on interdomain communication

  • Evolutionary Model:

    • Study Lema_P114090.1 as a model of gene fusion and functional adaptation

    • Compare with homologous systems in other fungi to trace evolutionary trajectories

    • Investigate whether the bifunctional arrangement offers selective advantages

  • Synthetic Biology Applications:

    • Use Lema_P114090.1 as a template for designing artificial bifunctional enzymes

    • Explore the potential for creating novel carotenoid biosynthesis pathways

    • Test domain fusion approaches for enhancing metabolic channeling in engineered pathways

  • Educational Tool:

    • Develop Lema_P114090.1 as a model system for teaching concepts in enzyme kinetics

    • Create laboratory exercises demonstrating domain cooperation and substrate channeling

    • Use as a case study for protein engineering and synthetic biology courses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.