Recombinant Leptosphaeria maculans C-5 sterol desaturase (ERG3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leptosphaeria maculans C-5 Sterol Desaturase (ERG3)

Recombinant Leptosphaeria maculans C-5 sterol desaturase, also known as ERG3, is a protein derived from the fungus Leptosphaeria maculans, which is commonly referred to as the blackleg fungus. This fungus is a significant pathogen affecting Brassica species, including canola and oilseed rape. The ERG3 enzyme plays a crucial role in the biosynthesis of ergosterol, a key sterol component in fungal cell membranes, by catalyzing the desaturation of sterols at the C-5 position .

Structure and Expression of Recombinant ERG3

The recombinant ERG3 protein is expressed in Escherichia coli (E. coli) and consists of 356 amino acids. It is tagged with a His-tag at the N-terminal end to facilitate purification. The protein is available in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .

SpecificationDescription
SpeciesLeptosphaeria maculans (Blackleg fungus)
SourceE. coli
TagHis-tag
Protein LengthFull Length (1-356 amino acids)
FormLyophilized powder
PurityGreater than 90%
StorageStore at -20°C/-80°C

Function and Role of ERG3

ERG3 is involved in the ergosterol biosynthesis pathway, which is essential for maintaining the integrity and fluidity of fungal cell membranes. Ergosterol is the fungal equivalent of cholesterol in animal cells and plays a critical role in cell membrane structure and function. The desaturation reaction catalyzed by ERG3 is crucial for the conversion of certain sterol precursors into ergosterol .

Research Findings and Applications

Research on ERG3 and similar enzymes has provided insights into the mechanisms of sterol biosynthesis in fungi. This knowledge can be applied in the development of antifungal agents targeting the ergosterol biosynthesis pathway. Additionally, understanding the role of ERG3 in Leptosphaeria maculans can contribute to strategies for managing blackleg disease in Brassica crops .

References Creative Biomart. Recombinant Full Length Leptosphaeria maculans C-5 Sterol Desaturase (ERG3) Protein, His-Tagged. ScienceOpen. Functional Characterization of the Chlamydomonas... Frontiers in Plant Science. The receptor-like kinase SOBIR1 interacts with Brassica napus...

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its implementation if possible.
Synonyms
ERG3; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Leptosphaeria maculans (Blackleg fungus) (Phoma lingam)
Target Names
ERG3
Target Protein Sequence
MDIVLEVCDTFLFDPLYATLLPAQASSFTANATANATLSSIRQEPTAYALPHASWQYEPA TKYFSIEPSKYAYMSSWPRDDWRRQALTLYLITWLFGVCVYYLFAGLSYLLVFDKATFNH PRYLKHQIKLEMKQANIAFPIMAIFTVPWFLAEVRGYSKLYDTTEKGPGRWYDYLQIPFF IAFTDLCIYWIHRGLHHPMVYKHIHKPHHKWIMPTPFASHAFHPIDGYAQGLPYYIFPFL FPLSKIASVAFFVFVNIWTVLIHDGEYAHNSPIINGAACHTMHHLYFNYNYGQFTTLWDR LGGSYRKPNDELFKRELKMCQDEWNKQAKAVDMMVEQVEGENDRSYQGEPESKKVQ
Uniprot No.

Target Background

Function
Catalyzes the introduction of a C-5 double bond in the B ring of ergosterol. It may contribute to the regulation of ergosterol biosynthesis.
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is C-5 sterol desaturase and what role does it play in fungal membranes?

C-5 sterol desaturase (ERG3) is an essential enzyme in the ergosterol biosynthetic pathway that introduces a double bond at the C-5 position in the sterol ring structure. Specifically, it catalyzes the conversion of episterol to ergosta intermediates by adding a double bond in the ring structure, a critical step in ergosterol production . Ergosterol serves as the predominant sterol in fungal cell membranes, affecting membrane fluidity, permeability, and structural integrity. In fungi like Leptosphaeria maculans, proper ergosterol biosynthesis is vital for cell viability, growth, and pathogenicity against host plants such as Brassica species.

What experimental approaches can verify ERG3 function in Leptosphaeria maculans?

To verify ERG3 function in L. maculans, several complementary approaches can be employed:

  • Heterologous expression and complementation: Express L. maculans ERG3 in Saccharomyces cerevisiae erg3Δ mutants and assess restoration of ergosterol biosynthesis and reversal of erg3Δ-associated phenotypes (cycloheximide sensitivity, inability to grow on non-fermentable carbon sources) .

  • Gene knockout analysis: Generate L. maculans ERG3 deletion mutants using homologous recombination with selectable markers (similar to the approach used with Aspergillus fumigatus) . This would involve designing primers to amplify flanking regions of the target gene and creating a construct with a selectable marker (e.g., hygromycin resistance).

  • Biochemical assays: Analyze sterol profiles using gas chromatography-mass spectrometry (GC-MS) to identify changes in ergosterol and intermediate sterols in wild-type versus mutant strains.

  • Phenotypic characterization: Evaluate growth, morphology, and pathogenicity of ERG3 mutants to assess the gene's role in L. maculans biology and virulence.

What are the optimal strategies for cloning the L. maculans ERG3 gene?

The optimal cloning strategy for L. maculans ERG3 should consider both genomic DNA and cDNA approaches:

  • Initial sequence identification: Design degenerate primers based on conserved regions from related fungal ERG3 genes. As observed in A. fumigatus research, sequenced tags showing homology to C-5 sterol desaturases can be used as starting points .

  • Full-length gene amplification: For genomic DNA, design primers to amplify the complete coding sequence plus ~1 kb flanking regions to capture promoter elements. For cDNA, perform RT-PCR using RNA extracted from actively growing L. maculans cultures.

  • Cloning vector selection: For functional studies, use expression vectors compatible with both E. coli (for propagation) and yeast (for functional complementation). The pGEM-T Easy vector system has been successfully used for initial cloning of fungal ERG3 genes .

  • Sequence verification: Confirm the cloned sequence through bidirectional sequencing and compare with predicted ERG3 sequences from related fungi. Pay special attention to conserved histidine-rich motifs characteristic of sterol desaturases.

  • Expression optimization: For recombinant protein production, consider codon optimization for the expression host and inclusion of appropriate affinity tags that don't interfere with enzymatic activity.

Which expression systems are most effective for producing active recombinant L. maculans ERG3?

The choice of expression system significantly impacts the yield and activity of recombinant ERG3:

Expression SystemAdvantagesDisadvantagesBest Applications
S. cerevisiae- Native ergosterol pathway
- Post-translational modifications
- Functional complementation possible
- Lower protein yields
- Potential interference from endogenous pathway
- Functional studies
- Complementation assays
Pichia pastoris- Higher protein expression
- Secretion possible
- Post-translational modifications
- Longer development time
- More complex media requirements
- Protein production for enzymatic studies
E. coli- Rapid growth
- High yields
- Simple media
- Lack of post-translational modifications
- Potential inclusion body formation
- Membrane protein expression challenges
- Initial characterization
- Antibody production
Baculovirus/insect cells- Higher eukaryotic system
- Complex protein folding
- Post-translational modifications
- Higher cost
- Technical complexity
- Longer production time
- Structural studies
- Complex functional assays

For functional studies, S. cerevisiae expression is particularly valuable as it allows for complementation assays in erg3Δ mutants, similar to the approach used for Chlamydomonas ERG3 . When producing the protein for enzymatic characterization or structural studies, insect cell or Pichia pastoris systems may offer better yields while maintaining proper folding and post-translational modifications.

How can yeast complementation assays be optimized for L. maculans ERG3 functional verification?

Yeast complementation assays represent a powerful approach for verifying L. maculans ERG3 function, building upon successful strategies employed with other fungal ERG3 genes:

  • Strain selection: Use S. cerevisiae erg3Δ knockout strains with well-characterized phenotypes. The most reliable strains display clear phenotypes including cycloheximide hypersensitivity and inability to grow on non-fermentable carbon sources .

  • Expression vector design: Employ vectors with constitutive promoters (e.g., ADH1, PGK1) for stable expression, or inducible promoters (e.g., GAL1) for controlled expression levels. Include selectable markers (e.g., LEU2) for efficient transformant selection .

  • Phenotypic assays for functional verification:

    • Cycloheximide sensitivity testing at non-lethal concentrations (0.1-0.15 μg/ml)

    • Growth assessment on non-fermentable carbon sources like acetate

    • Sterol profile analysis using GC-MS to confirm ergosterol biosynthesis restoration

  • Controls: Include both positive (yeast ERG3 complementation) and negative (empty vector) controls in all assays, as was demonstrated in the Chlamydomonas ERG3 functional studies .

  • Optimization considerations: If initial complementation results are weak, optimize codon usage for yeast expression or test different promoter strengths to improve expression levels.

What analytical methods are most effective for characterizing sterol profiles in ERG3 mutants?

Comprehensive sterol profile analysis is essential for connecting ERG3 function to specific biochemical changes:

  • Extraction protocols: Use alkaline hydrolysis followed by organic solvent extraction (e.g., hexane or chloroform:methanol mixtures) to isolate total sterols from fungal cells. The extraction method must be optimized for complete recovery of all sterol intermediates.

  • Analytical techniques:

    • Gas Chromatography-Mass Spectrometry (GC-MS): The gold standard for sterol analysis, providing separation and identification of different sterols. Look for characteristic mass ions (e.g., m/z 468, 363, 337, and 253 have been described as ergosterol mass ions) .

    • Liquid Chromatography-Mass Spectrometry (LC-MS): Provides complementary analysis, especially useful for thermally labile sterol derivatives.

    • Thin Layer Chromatography (TLC): Can serve as a rapid screening method before more detailed analyses.

  • Key sterols to monitor:

    • Ergosterol (final product)

    • Episterol (substrate for ERG3)

    • Ergosta-5,7,24(28)-trienol (product of ERG3 action)

    • Ergosta-7,24(28)-dienol (accumulates in erg3 mutants)

  • Data analysis approach: Quantify relative abundances of different sterols and calculate conversion ratios to assess enzymatic efficiency. Compare profiles between wild-type, mutant, and complemented strains to identify specific blocks in the pathway.

How does L. maculans ERG3 function compare to the dual ERG3 system in Aspergillus fumigatus?

The comparison between L. maculans ERG3 and the dual ERG3 system in A. fumigatus provides valuable insights into functional conservation and specialization:

A. fumigatus possesses two distinct C-5 sterol desaturase genes (erg3A and erg3B), with differential roles in ergosterol biosynthesis . Notably:

  • Functional redundancy vs. specialization: In A. fumigatus, Erg3B functions as the primary C-5 sterol desaturase, while Erg3A shows no apparent role in ergosterol biosynthesis . Researchers should determine whether L. maculans possesses single or multiple ERG3 genes, and if multiple, characterize their respective contributions to sterol biosynthesis.

  • Essential nature: Neither erg3A nor erg3B is essential for A. fumigatus viability, as demonstrated by viable knockout mutants . Viability testing of L. maculans ERG3 knockouts would determine whether this non-essentiality is conserved.

  • Antifungal susceptibility: Unlike expectations from other fungi, A. fumigatus erg3 mutations did not alter susceptibility to polyene or azole antifungals . Testing L. maculans ERG3 mutants for antifungal susceptibility would reveal whether this unexpected phenotype is unique to Aspergillus or more widespread among plant pathogenic fungi.

  • Genetic approach: For meaningful comparison, researchers should employ similar gene targeting strategies, creating both single and (if applicable) multiple ERG3 gene knockouts in L. maculans using comparable selectable markers and verification methods.

What insights can functional studies of ERG3 in model organisms provide for L. maculans research?

Functional studies in model organisms offer valuable frameworks for L. maculans ERG3 research:

  • From S. cerevisiae studies:

    • Non-essentiality under aerobic conditions but critical role in ergosterol biosynthesis

    • Specific phenotypes (cycloheximide sensitivity, inability to grow on non-fermentable carbon sources) that provide clear functional assays

    • Complementation approaches that have successfully verified ERG3 function across species

  • From Chlamydomonas reinhardtii studies:

    • Demonstration that even with low sequence identity (21%), functional conservation can exist

    • Importance of conserved histidine-rich motifs for enzymatic function

    • Successful heterologous expression strategies for algal ERG3 in yeast systems

  • From A. fumigatus studies:

    • Potential for multiple ERG3 genes with different functional roles

    • Methods for simultaneous targeting of multiple related genes

    • Unexpected relationship between ERG3 function and antifungal resistance

Research on L. maculans ERG3 should incorporate these insights, particularly the complementation strategies demonstrated with Chlamydomonas ERG3 and the targeted gene disruption approaches used in A. fumigatus.

How might ERG3 function influence L. maculans pathogenicity in Brassica crops?

The relationship between ERG3 function and L. maculans pathogenicity can be examined from multiple perspectives:

  • Membrane integrity and environmental adaptation: Proper ergosterol composition affects membrane fluidity and stability, which may be crucial for L. maculans adaptation to the plant environment. ERG3 mutants may show altered ability to respond to plant defense compounds or environmental stresses encountered during infection.

  • Plant defense response interactions: L. maculans infection of Brassica crops induces significant changes in glucosinolate profiles, with both aliphatic and indolic glucosinolates associated with resistance . Membrane sterols may influence the fungus's ability to detoxify or withstand these defense compounds. Research should examine whether ERG3 mutations alter L. maculans sensitivity to specific glucosinolates, particularly glucoiberverin (GIV), glucoerucin (GER), and indolic glucosinolates that increase dramatically in resistant Brassica lines .

  • Virulence factor production and secretion: Membrane composition affects protein secretion and potentially impacts the production and delivery of virulence factors. Studies should assess whether ERG3 mutations alter the secretion of known L. maculans virulence factors.

  • Experimental approach: Create L. maculans ERG3 knockout strains and compare their ability to:

    • Penetrate and colonize Brassica tissues

    • Induce changes in host glucosinolate profiles

    • Withstand plant defense compounds

    • Produce disease symptoms compared to wild-type strains

What methodologies can effectively measure the impact of ERG3 mutations on L. maculans fitness and virulence?

Comprehensive assessment of ERG3's role in L. maculans pathogenicity requires multiple complementary approaches:

  • In vitro fitness assays:

    • Growth rate measurements under various conditions (temperature, pH, osmotic stress)

    • Sporulation efficiency quantification

    • Stress tolerance testing (oxidative stress, plant antimicrobial compounds)

  • Infection assays:

    • Detached leaf assays with measurement of lesion size and development rate

    • Whole plant pathogenicity tests with disease severity scoring

    • Quantitative PCR to measure fungal biomass accumulation in planta

    • Microscopy to assess infection structure formation and plant tissue colonization

  • Host response analysis:

    • Quantification of glucosinolate profile changes in response to wild-type vs. ERG3 mutant infection

    • Measurement of defense gene expression in the host plant

    • Analysis of reactive oxygen species production and callose deposition at infection sites

  • Comparative virulence assessment:

    • Competition assays between wild-type and ERG3 mutant strains in mixed infections

    • Complementation studies to confirm that virulence defects are specifically due to ERG3 mutation

The association between glucosinolate production in resistant Brassica lines and L. maculans infection provides a useful marker for assessing the impact of ERG3 mutations on host-pathogen interactions .

What are the key considerations for developing ERG3-targeted antifungal strategies against L. maculans?

Developing ERG3-targeted antifungal strategies requires careful consideration of several factors:

  • Target validation assessment:

    • Determine whether ERG3 is essential for L. maculans survival in planta

    • Assess whether ERG3 inhibition affects virulence even if not lethal

    • Evaluate potential for resistance development through bypass pathways

  • Inhibitor design considerations:

    • Focus on conserved catalytic domains, particularly the histidine-rich motifs essential for function

    • Consider the structural differences between fungal ERG3 and plant sterol desaturases to ensure specificity

    • Design inhibitors that can penetrate the fungal cell wall and membrane

  • Screening methodologies:

    • Develop heterologous expression systems for high-throughput screening

    • Establish clear biochemical assays measuring C-5 desaturase activity

    • Create yeast-based screening systems using erg3Δ mutants complemented with L. maculans ERG3

  • Resistance management strategy:

    • Consider targeting multiple steps in the ergosterol pathway simultaneously

    • Assess cross-resistance with existing azole fungicides

    • Examine the potential for combination treatments with compounds affecting different cellular targets

  • Agricultural application parameters:

    • Formulation requirements for field application

    • Stability under field conditions

    • Environmental impact and non-target effects assessment

What technical challenges might researchers encounter when working with recombinant L. maculans ERG3 and how can they be addressed?

Researchers working with recombinant L. maculans ERG3 may encounter several technical challenges:

ChallengeCauseSolution
Low expression levelsCodon bias, toxicity to host, protein instability- Optimize codons for expression host
- Use inducible promoters
- Include solubility tags (MBP, SUMO)
- Test multiple expression hosts
Protein insolubilityHydrophobic membrane protein nature- Express with membrane-targeting sequences
- Use detergents for extraction (DDM, CHAPS)
- Consider nanodiscs or liposome reconstitution
- Express truncated soluble domains
Enzymatic activity lossImproper folding, cofactor absence, membrane environment absence- Include essential cofactors (iron, oxygen)
- Reconstitute in lipid environments
- Co-express with chaperones
- Test activity in microsomal preparations
Complementation failureExpression level issues, protein misfolding, host compatibility- Try different promoters
- Optimize growth conditions
- Consider using closer fungal relatives as hosts
- Create chimeric proteins with yeast domains
Gene targeting difficultiesLow homologous recombination efficiency in L. maculans- Use CRISPR/Cas9 systems for improved targeting
- Increase homology arm length
- Disrupt non-homologous end joining pathways
- Optimize transformation protocols for filamentous fungi

For membrane protein expression specifically, researchers should consider specialized approaches such as cell-free expression systems or the use of fungal expression hosts that more closely match the native lipid environment of L. maculans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.