Recombinant Leptosphaeria maculans Probable endonuclease LCL3 (LCL3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leptosphaeria maculans Probable Endonuclease LCL3 (LCL3)

Recombinant Leptosphaeria maculans Probable Endonuclease LCL3 (LCL3) is a bioengineered protein derived from Leptosphaeria maculans, the pathogen responsible for blackleg disease in oilseed rape (Brassica napus). This enzyme is annotated as a probable endonuclease (EC 3.1.-.-) with a predicted role in nucleic acid processing. Below is a detailed analysis of its molecular characteristics, production parameters, and genomic context, synthesized from available data.

Genomic and Evolutionary Context

LCL3 is located in AT-rich genomic regions of L. maculans, which are enriched with repetitive elements and transposable remnants. These regions are prone to repeat-induced point (RIP) mutations, a defense mechanism in fungi that disrupts duplicated sequences . While LCL3 itself has not been explicitly linked to RIP inactivation, its genomic neighborhood aligns with regions where avirulence genes (e.g., AvrLm1, AvrLm4-7) undergo epigenetic regulation via H3K9me3-mediated heterochromatin .

Production and Applications

LCL3 is commercially available as a recombinant protein for research purposes, including enzyme activity assays and immunological studies.

ParameterDetails
Product TypeRecombinant protein
Quantity50 µg (customizable)
Tag InfoDetermined during production (not specified)
Host SystemBacterial or eukaryotic (unconfirmed)
ApplicationsELISA, biochemical assays, structural studies

No peer-reviewed studies directly investigating LCL3’s enzymatic activity or biological role have been identified in the literature.

Research Gaps and Future Directions

While LCL3 is annotated as an endonuclease, its specific substrates, catalytic mechanisms, and in vivo functions remain uncharacterized. Key areas for investigation include:

  1. Functional Validation: Biochemical assays to confirm nuclease activity (e.g., plasmid cleavage, RNA/DNA degradation).

  2. Structural Analysis: X-ray crystallography or cryo-EM to identify catalytic residues and domain architecture.

  3. Pathogenicity Link: Determining whether LCL3 contributes to host-pathogen interactions, particularly in DNA/RNA processing during infection.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LCL3; Lema_P027230.1; Probable endonuclease LCL3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam)
Target Names
LCL3
Target Protein Sequence
MRWPWSGHDEEKKRNAATRSKRAETANSWTGTLLESRTLVPSVALTVSTVLGLRLYKAYF RRIPTVNHIKPDYFRRRTLFGQVTSVGDADNFRLYHTPGGRLAGWGWLPWKTVPTKREAL VKQTVGPVLILWRLRPRRISSDWMLKAIQLHIRIAGVDAPELAHWGREAQPYSKEALDWL TQLILHQRVRVRLYRRDQYDRVVAQVYYRRWFFRQDVGLEMLKMGLATVYEAKSGAEFGD VEQQYRAAEEKAKESRAGMWAKPNLLQRLGGAGTKAPESPREYKSRHTAAEKQKKAAW
Uniprot No.

Target Background

Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Leptosphaeria maculans probable endonuclease LCL3?

LCL3 (gene name: LCL3, ORF name: Lema_P027230.1) is a probable endonuclease encoded by the fungal plant pathogen Leptosphaeria maculans. The protein consists of 298 amino acids, contains a predicted secretion signal, and is encoded by a gene located in an AT-rich region of the L. maculans genome, which is characteristic of many effector proteins in this organism . As an endonuclease, it likely plays a role in nucleic acid metabolism, potentially contributing to the pathogen's virulence mechanisms through interaction with host DNA or RNA.

How does LCL3 compare to other known effector proteins in L. maculans?

While LCL3 shares the common characteristics of L. maculans effector proteins (cysteine-rich, relatively small size, presence of secretion signal), it has limited sequence homology with other characterized avirulence proteins like AvrLm1, AvrLm4-7, or AvrLmS-Lep2 . Database analyses indicate that LCL3 has weak homology with another candidate effector gene in L. maculans (Lmb_jn3_03815; 39.50% identity, e-value=1e-20) , suggesting a possible evolutionary relationship or functional similarity between these proteins.

What are optimal expression systems for producing recombinant LCL3?

Methodological approach:

When expressing recombinant LCL3, researchers should consider several expression systems depending on research objectives:

  • E. coli expression systems: For high-yield purification, BL21(DE3) or Rosetta strains with pET vectors containing optimized codons for fungal genes are recommended. Inclusion of a 6xHis-tag facilitates purification while fusion partners like GST or MBP can enhance solubility.

  • Yeast expression systems (S. cerevisiae or P. pastoris): When post-translational modifications are crucial, these systems provide eukaryotic processing capabilities.

  • Baculovirus-insect cell system: For complex proteins requiring extensive folding or modifications.

For functional studies, expression optimization should focus on maintaining native folding and activity rather than maximizing yield. Protein purification typically employs IMAC (Immobilized Metal Affinity Chromatography) followed by size exclusion chromatography to ensure high purity .

How should researchers design experiments to study the enzymatic activity of LCL3?

Studying LCL3 enzymatic activity requires a systematic experimental approach that builds from basic biochemical characterization to complex substrate interactions:

  • Substrate preference determination:

    • Test multiple nucleic acid substrates (ssDNA, dsDNA, RNA)

    • Use radiolabeled or fluorescently labeled oligonucleotides to visualize cleavage products

    • Analyze products using gel electrophoresis to determine cleavage patterns

  • Optimal reaction conditions assessment:

    • Create a reaction condition matrix testing:

    ParameterRange to test
    pH5.0-9.0 (0.5 increments)
    Temperature4-50°C (10°C increments)
    Metal ion cofactorsMg²⁺, Mn²⁺, Ca²⁺, Zn²⁺ (0-10 mM)
    Salt concentration0-500 mM NaCl or KCl
  • Kinetic analysis:

    • Determine Km, kcat, and kcat/Km for preferred substrates

    • Evaluate enzyme processivity and rate-limiting steps

  • Interaction with potential inhibitors:

    • Test plant-derived defense compounds

    • Assess influence of pH and ionic strength on inhibition

Remember to include appropriate controls: heat-inactivated enzyme, catalytic site mutants, and commercially available endonucleases with known activity profiles .

What is the role of LCL3 in L. maculans virulence and host-pathogen interactions?

Understanding LCL3's role in virulence requires a multifaceted approach combining genetic manipulation, transcriptomics, and pathogenicity assays:

  • Gene deletion and complementation studies: CRISPR/Cas9 can be employed to generate LCL3 knockout mutants in L. maculans, followed by complementation with the wild-type gene to confirm phenotypes are directly attributable to LCL3 loss. This approach has been successfully used for other L. maculans genes like AvrLm7 .

  • Expression profiling: RT-qPCR and RNA-seq analyses during infection reveal expression patterns across infection stages. Evidence from other L. maculans effectors suggests that peak expression likely occurs during early infection phases (4-7 days after infection), prior to symptom development .

  • Subcellular localization: Fluorescently-tagged LCL3 variants can be used to track protein localization in planta, determining whether it remains in the apoplast or enters host cells.

  • Interaction partner identification: Yeast two-hybrid screening or co-immunoprecipitation coupled with mass spectrometry can identify host proteins that interact with LCL3, potentially revealing its molecular targets.

The expected outcome of these experiments may reveal whether LCL3 functions as an avirulence protein (recognized by plant resistance proteins) or as a virulence factor that enhances pathogen fitness in susceptible hosts .

How does genetic variation in LCL3 across L. maculans isolates correlate with virulence phenotypes?

To investigate genetic variation in LCL3 and its correlation with virulence:

  • Sequence analysis across populations: Collect LCL3 sequences from geographically diverse L. maculans isolates. This approach, similar to that used for AvrLmS-Lep2 where eight nucleotide changes (four resulting in non-synonymous amino acid substitutions) were identified across 36 isolates , can reveal polymorphisms potentially linked to virulence.

  • Structure-function relationship studies: Use site-directed mutagenesis to introduce specific amino acid changes identified in field isolates into recombinant LCL3 and assess impact on:

    • Protein stability and secretion

    • Enzymatic activity

    • Recognition by plant defense systems

  • Complementation studies in diverse genetic backgrounds: Introduce variant LCL3 alleles into reference isolates to assess phenotypic effects.

  • Field isolate phenotyping: Characterize isolates with known LCL3 variants in standardized pathogenicity assays on differential plant lines.

Research on other L. maculans effectors has demonstrated that even single nucleotide polymorphisms can dramatically alter virulence profiles, as seen with AvrLm4-7 where a glycine to arginine substitution affects recognition by the Rlm4 resistance gene while maintaining Rlm7 recognition .

How can researchers design effective quasi-experimental studies to investigate LCL3 function in planta?

When investigating LCL3 function in planta, quasi-experimental study designs can provide robust evidence when randomized controlled trials are impractical. Based on guidelines from medical informatics literature applicable to plant pathology research , consider:

  • Interrupted time-series design with multiple measurements:

    • Perform regular measurements (fungal biomass, gene expression, etc.) before, during, and after LCL3 expression or application

    • Format: O₁ O₂ O₃ O₄ O₅ X O₆ O₇ O₈ O₉ O₁₀ (where O = observation, X = LCL3 introduction)

    • This design controls for temporal trends unrelated to the intervention

  • Untreated control group design with switching replications:

    • Split plants into two groups: initially treat only Group A with LCL3 while Group B serves as control

    • After measurements, switch conditions (apply LCL3 to Group B)

    • Format:
      Group A: O₁ᵃ X O₂ᵃ O₃ᵃ
      Group B: O₁ᵇ O₂ᵇ X O₃ᵇ

    • This design allows each group to serve as its own control and strengthens causal inference

  • Measuring relevant outcomes:

    • Pathogen colonization using qPCR (as demonstrated in studies of L. maculans biomass quantification)

    • Plant defense responses (e.g., lignification, reactive oxygen species)

    • Gene expression changes in both pathogen and host

    • Symptom development and severity

When analyzing results, employ statistical models that account for repeated measurements and potential confounders like environmental conditions .

What storage and handling conditions are optimal for maintaining LCL3 stability and activity?

Based on recommended protocols for similar recombinant proteins, the following storage and handling conditions are advised for LCL3:

  • Short-term storage (1-7 days):

    • Store working aliquots at 4°C

    • Maintain in Tris-based buffer with 50% glycerol

  • Long-term storage:

    • Store at -20°C for routine use

    • For extended periods, maintain at -80°C

    • Avoid repeated freeze-thaw cycles which can compromise activity

    • Prepare small single-use aliquots upon initial thawing

  • Handling recommendations:

    • Thaw protein samples on ice

    • Centrifuge briefly before opening tubes to collect condensation

    • Use low-protein binding tubes for dilutions

    • Include protease inhibitors in working solutions

    • Validate protein activity periodically through activity assays

How can researchers develop sensitive detection methods for LCL3 in complex biological samples?

Developing sensitive detection methods for LCL3 in complex biological samples requires combining established protein detection technologies with LCL3-specific adaptations:

  • Antibody-based detection:

    • Generate polyclonal or monoclonal antibodies against recombinant LCL3

    • Develop ELISA protocols with a detection limit of approximately 0.1-1 ng/mL

    • Implement Western blotting with chemiluminescent detection for enhanced sensitivity

  • Activity-based detection:

    • Design fluorogenic nucleic acid substrates that produce measurable signal when cleaved

    • Develop gel-based activity assays using radiolabeled substrates

  • Mass spectrometry protocols:

    • Optimize sample preparation to enrich for LCL3 (immunoprecipitation or affinity purification)

    • Develop multiple reaction monitoring (MRM) assays focusing on unique LCL3 peptides

    • Create a database of LCL3-specific peptide masses and retention times

  • qPCR for transcript detection:

    • Design specific primers for LCL3 gene

    • Establish standard curves using known quantities of LCL3 plasmid

    • Adapt protocols from existing L. maculans quantification methods that can detect fungal DNA at concentrations as low as 5 pg

These methods can be combined to track both protein abundance and activity in infected plant tissues throughout the infection process.

How should researchers interpret contradictory data regarding LCL3 function in different experimental systems?

When faced with contradictory data regarding LCL3 function, researchers should employ a systematic approach to reconcile discrepancies:

  • Examine experimental contexts:

    • Compare in vitro vs. in planta systems

    • Evaluate differences in host genotypes and environmental conditions

    • Consider temporal aspects of infection and sampling timing

  • Analyze methodological differences:

    • Evaluate protein purification and preparation methods

    • Compare detection sensitivity and specificity across studies

    • Assess statistical approaches and sample sizes

  • Consider biological variables:

    • Investigate LCL3 allelic variants used in different studies

    • Examine post-translational modifications

    • Assess potential interaction partners present in different systems

  • Implement validation approaches:

    • Design experiments that specifically test competing hypotheses

    • Use multiple complementary methods to assess the same function

    • Consider quasi-experimental designs with interrupted time-series

Research on other L. maculans effectors has demonstrated that environmental conditions, plant genetic background, and experimental conditions can significantly influence interaction phenotypes . For example, the AvrLmS-Lep2 gene exhibits variable phenotypes depending on experimental conditions, despite consistent molecular interactions .

How can researchers accurately quantify LCL3 expression during the infection process?

To accurately quantify LCL3 expression during infection, researchers should employ a multi-method approach that captures both transcript and protein dynamics:

  • Transcript quantification:

    • RT-qPCR with LCL3-specific primers, using reference genes stable during infection

    • RNA-seq for genome-wide context of expression patterns

    • Digital droplet PCR for absolute quantification in samples with low pathogen biomass

  • Sampling strategy:

    • Collect samples at multiple timepoints (e.g., 0, 3, 5, 7, 9, 12 days post-inoculation)

    • Include both infected and surrounding tissues

    • Process samples immediately to prevent RNA degradation

  • Data normalization approaches:

    • Normalize to fungal housekeeping genes (e.g., actin, EF1-α) to account for variations in fungal biomass

    • Use multiple reference genes for robust normalization

    • Implement both relative and absolute quantification methods

  • Data analysis and visualization:

    • Generate temporal expression profiles

    • Compare with expression patterns of known avirulence genes

    • Correlate expression with symptom development and fungal growth stages

Studies of other L. maculans effectors have shown that expression typically peaks between 4-7 days after infection, prior to symptom development, with similar expression patterns observed among co-regulated effector genes .

What are the best experimental designs for identifying host targets of LCL3?

To identify host targets of LCL3, researchers should implement complementary approaches that capture different aspects of protein-target interactions:

  • Affinity purification coupled with mass spectrometry (AP-MS):

    • Express tagged LCL3 (His-tag, FLAG-tag, or biotin-tag) in planta

    • Perform pull-down experiments with appropriate controls

    • Identify co-purifying proteins using LC-MS/MS

    • Validate interactions through reciprocal pull-downs

  • Yeast two-hybrid screening:

    • Screen LCL3 against cDNA libraries from susceptible and resistant host plants

    • Compare interaction profiles between hosts with different resistance genes

    • Validate candidate interactions using targeted Y2H assays

  • In vitro biochemical approaches:

    • Test LCL3 activity against candidate nucleic acid substrates

    • Perform gel-shift assays to detect direct binding to DNA or RNA

    • Use chromatin immunoprecipitation (ChIP) to identify genomic binding sites

  • Functional validation in planta:

    • Silence or mutate candidate target genes using RNAi or CRISPR

    • Assess impact on LCL3-mediated phenotypes

    • Complement mutants with modified variants resistant to LCL3 activity

  • Subcellular co-localization studies:

    • Fluorescently tag LCL3 and candidate targets

    • Examine co-localization using confocal microscopy

    • Implement FRET or BiFC to confirm direct interactions

These approaches should be integrated with data on the temporal and spatial expression patterns of both LCL3 and candidate targets during infection to establish biological relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.