Recombinant Leptosphaeria maculans Signal peptidase complex catalytic subunit SEC11 (SEC11)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEC11; Lema_P074660; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-173
Protein Length
full length protein
Species
Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam)
Target Names
SEC11
Target Protein Sequence
MLGVSGMQPRQLAAQILNFALVLSTAFMMWKGLSVVSDSSSPIVVVLSGSMEPAFQRGDL
LFLWNRGLDTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNIADDTELYA
TSQSFLTRKEDVVGSVVGFIPFVGYVTILLSENPWMKQVMLGLMGVMVVLQRE
Uniprot No.
Target Background
Function
The recombinant Leptosphaeria maculans Signal peptidase complex catalytic subunit SEC11 (SEC11) is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum. This signal peptide cleavage occurs during translocation—either co-translationally or post-translationally—through the translocon pore into the endoplasmic reticulum.
Database Links
STRING: 5022.CBX99877
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
