Recombinant Leptospira biflexa serovar Patoc ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leptospira biflexa serovar Patoc ATP Synthase Subunit b (atpF)

Recombinant Leptospira biflexa serovar Patoc ATP synthase subunit b (atpF) is a protein produced through recombinant DNA technology in an in vitro Escherichia coli expression system. This protein is a component of the ATP synthase complex, which plays a crucial role in generating ATP from ADP using the energy derived from a proton gradient across the cell membrane .

Function and Importance of ATP Synthase

ATP synthase is an enzyme that catalyzes the synthesis of ATP from ADP and inorganic phosphate (Pi) using the energy from a proton gradient across the membrane. The beta subunits of ATP synthase, similar to the function of subunit b, host the catalytic sites where ATP is produced . In bacteria like Leptospira biflexa, ATP synthase is essential for maintaining cellular energy homeostasis.

Characteristics of Recombinant atpF

  • Production Method: The recombinant protein is produced in an E. coli expression system, which allows for high purity and controlled production conditions .

  • Source Organism: The gene encoding atpF is derived from Leptospira biflexa serovar Patoc, a saprophytic species of the genus Leptospira, which serves as a model organism for studying leptospiral physiology .

  • KEGG Identifier: The protein is associated with the KEGG identifier lbf:LBF_0774 .

Data Table: Characteristics of Recombinant Leptospira biflexa serovar Patoc ATP Synthase Subunit b (atpF)

CharacteristicDescription
Production SystemIn vitro E. coli expression system
Source OrganismLeptospira biflexa serovar Patoc
KEGG Identifierlbf:LBF_0774
FunctionComponent of ATP synthase complex
PurityHigh purity

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your own protocols.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C, while lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
atpF; LBF_0774; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-174
Protein Length
full length protein
Species
Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Target Names
atpF
Target Protein Sequence
MVLLAASGFNLLKVNPGLVIWTLVTFSVVVFVLKKFAWDKILHALEERASGIQGDINKAE SLRVEAEKSLKEYKDQLFKATEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVRE IELAKGRALSEIQNQIVEMSVLIASEILEKQLKKEDYASFVEKEIAKLDKLKIK
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases comprise two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel, forming part of the peripheral stalk that connects F(1) and F(0).

Database Links

KEGG: lbf:LBF_0774

Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does ATP synthase function differ between pathogenic and non-pathogenic Leptospira species?

Pathogenic (e.g., L. interrogans) and non-pathogenic (e.g., L. biflexa) Leptospira species exhibit notable differences in their ATP generation and energy metabolism:

  • Growth requirements: L. biflexa shows more metabolic flexibility, growing in simple media, while pathogenic species have more complex nutritional needs.

  • Response to environmental stressors: Research indicates that L. biflexa mutants can grow with supplementation of hemin or δ-aminolevulinic acid (ALA) when certain two-component systems are disrupted . Pathogenic species like L. interrogans show different tolerances to metal ions such as Mn²⁺ .

  • Metal ion utilization: The ABC ATPase in L. biflexa (LEPBIa2866) and its ortholog in L. interrogans (LIC12079) display different phenotypes regarding metal utilization and tolerance . This suggests species-specific adaptations in energy metabolism components.

  • Gene organization: In L. interrogans, genes encoding components of energy systems like Hklep/Rrlep are clustered with heme biosynthetic genes, suggesting coordinated regulation of energy production and heme metabolism .
    These differences likely extend to ATP synthase components including atpF, reflecting adaptations to different ecological niches.

What expression systems are most effective for recombinant production of L. biflexa atpF?

Based on established protocols for Leptospira protein expression, the following systems are recommended for recombinant L. biflexa atpF production:

  • E. coli-based expression systems:

    • BL21(DE3) with pET vectors for high-yield cytoplasmic expression

    • C41(DE3) or C43(DE3) strains specifically optimized for membrane protein expression

    • Fusion tags: His6 tag for purification, MBP or SUMO for enhancing solubility

  • Optimization parameters:

    • Induction: Low IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-25°C)

    • Media supplementation: Addition of membrane-mimicking components

    • Expression duration: Extended expression periods (16-24 hours)

  • Alternative systems:

    • Cell-free expression systems with added lipids or detergents

    • Yeast expression systems (e.g., Pichia pastoris) for proteins requiring eukaryotic processing
      The successful expression of recombinant ABC ATPase from L. interrogans with preserved enzymatic activity demonstrates that Leptospira proteins can retain functional properties when expressed in heterologous systems .

What mutagenesis approaches are most effective for studying atpF function in Leptospira biflexa?

Several mutagenesis approaches have been successfully employed for studying Leptospira proteins:

  • Random mutagenesis:

    • Transposon mutagenesis using Himar1 has been effective in L. biflexa, as demonstrated in studies identifying genes involved in heme utilization

    • This approach allows for genome-wide screening of phenotypes

  • Targeted gene replacement:

    • Homologous recombination-based approaches have successfully generated deletion mutants in L. biflexa, as shown with rrlep and hklep genes

    • These systems allow for precise removal of target genes to study loss-of-function phenotypes

  • Site-directed mutagenesis:

    • For studying specific functional residues in proteins

    • Successfully used to identify critical phosphorylation sites in two-component systems (e.g., H98 in Hklep and D53 in Rrlep)

  • Complementation analysis:

    • Replicative plasmids carrying wild-type or mutant genes have been used to confirm gene function

    • This approach allows testing of orthologous genes from different Leptospira species
      For atpF specifically, targeted approaches could include introducing mutations in the transmembrane regions or in domains involved in interactions with other ATP synthase subunits.

How can protein-protein interactions involving atpF be effectively studied?

Several methodologies are appropriate for investigating atpF interactions with other ATP synthase components:

  • In vitro techniques:

    • Pull-down assays using purified recombinant proteins

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Chemical cross-linking followed by mass spectrometry

  • Structural studies:

    • X-ray crystallography (as used for the ABC ATPase LIC12079)

    • Cryo-electron microscopy for larger complexes

    • NMR for dynamic interaction studies

  • In vivo approaches:

    • Bacterial two-hybrid systems

    • Co-immunoprecipitation from Leptospira membranes

    • FRET-based assays using fluorescent protein fusions

  • Computational prediction:

    • Homology modeling based on related ATP synthases

    • Molecular dynamics simulations
      Research on LIC12079 has demonstrated that Leptospira ABC ATPases can form functional dimers with specific interaction interfaces involving conserved motifs (Walker A/B, ABC signature) . Similar approaches could reveal how atpF interacts within the ATP synthase complex.

What biophysical techniques provide the most valuable structural information about recombinant atpF?

The following biophysical techniques offer complementary structural insights for recombinant atpF characterization:

TechniqueInformation ObtainedAdvantagesLimitations
X-ray CrystallographyHigh-resolution 3D structureAtomic resolution; successful with Leptospira ABC ATPase Requires crystallization; challenging for membrane proteins
Cryo-EMMedium to high-resolution structuresWorks with larger complexes; no crystallization neededSample preparation challenges; lower resolution for small proteins
Circular DichroismSecondary structure estimationRapid assessment of folding; works in solutionLow resolution; limited structural details
NMR SpectroscopySolution structure; dynamicsInformation on protein flexibility; works in native-like conditionsSize limitations; complex data analysis
HDX-MSProtein dynamics; solvent accessibilityWorks with membrane proteins; identifies interaction regionsModerate resolution; requires specialized equipment
SAXS/SANSLow-resolution envelope; quaternary structureWorks in solution; complements high-resolution techniquesVery low resolution; shape information only
For Leptospira membrane proteins like atpF, a combination of techniques is recommended. Successful structural determination of a leptospiral ABC ATPase dimer demonstrates the feasibility of structural studies on Leptospira proteins .

How does metal ion availability influence ATP synthase function in Leptospira?

Metal ion homeostasis significantly impacts energy metabolism in Leptospira, with several mechanisms potentially affecting ATP synthase function:

  • Direct effects on ATP synthase:

    • Mg²⁺ is essential for ATPase activity, as demonstrated with the recombinant ABC ATPase of L. interrogans

    • Other divalent cations (Mn²⁺, Fe²⁺) may compete with or substitute for Mg²⁺ under certain conditions

  • Regulatory mechanisms:

    • Two-component systems like Hklep/Rrlep respond to environmental conditions and regulate heme biosynthesis genes

    • Changes in heme availability would impact electron transport chain function, consequently affecting proton gradient generation for ATP synthase

  • Metal transporters and ATP synthase:

    • The ABC ATPase identified in L. biflexa (LEPBIa2866) and L. interrogans (LIC12079) plays a role in Mn²⁺ utilization

    • Mutations in this ABC ATPase led to decreased growth when Fe²⁺ was replaced by Mn²⁺, suggesting complex interplay between metal transport systems and energy metabolism

  • Metal-dependent regulatory networks:

    • In L. biflexa, transcriptional analysis showed that heme biosynthesis genes (hemAEL) expression was significantly decreased in hklep and rrlep mutants

    • This indicates that metal-responsive regulatory systems can coordinate multiple metabolic pathways including energy production
      Research strategies could include measuring ATP synthase activity under varying metal concentrations and identifying metal-binding sites within the ATP synthase complex, including possible binding sites in atpF.

What role might atpF play in Leptospira adaptation to different environmental conditions?

ATP synthase subunit b (atpF) likely contributes to Leptospira environmental adaptation in several ways:

  • pH adaptation:

    • As part of the proton channel, atpF likely contributes to maintaining ATP synthesis across different environmental pH values

    • Leptospira encounters varying pH conditions in different hosts and environments

  • Energy conservation during nutrient limitation:

    • ATP synthase regulation is critical during nutrient scarcity

    • Studies on the Hklep/Rrlep two-component system show that L. biflexa mutants require heme or heme precursor supplementation for growth , suggesting sophisticated energy regulatory mechanisms

  • Response to osmotic stress:

    • ATP synthase activity may be modulated during osmotic challenges

    • atpF structural adaptations could contribute to maintaining membrane integrity under osmotic stress

  • Metal ion availability response:

    • Research on ABC ATPases in Leptospira demonstrates differential growth responses when Fe²⁺ is replaced by Mn²⁺

    • Similar adaptations may exist in ATP synthase components to function with varying metal cofactor availability

  • Host infection adaptation (for pathogenic species):

    • Comparison with pathogenic Leptospira species could reveal how ATP synthase components have evolved for different lifestyles

    • The ABC ATPase ortholog in L. interrogans showed different metal toxicity responses compared to L. biflexa
      Experimental approaches could include creating conditional atpF mutants and assessing growth under various environmental stressors, or comparing atpF sequences across Leptospira species from different ecological niches.

How can structural insights into atpF inform vaccine design strategies?

Structural characterization of atpF could contribute to vaccine development through several approaches:

  • Epitope identification:

    • High-resolution structures allow identification of surface-exposed epitopes

    • These epitopes can be screened for conservation across pathogenic Leptospira strains

    • Accessible epitopes are prime targets for bactericidal antibodies

  • Structure-based antigen design:

    • Understanding atpF topology in the membrane helps identify extracellular domains

    • These domains can be expressed as recombinant proteins for subunit vaccines

    • Structural data enables rational engineering to enhance immunogenicity

  • Cross-protection analysis:

    • Structural conservation analysis between L. biflexa and pathogenic species

    • Identification of conserved structural motifs across serovars could lead to broadly protective vaccines

  • Stability engineering:

    • Structural insights allow modifications to enhance protein stability

    • This is critical for maintaining epitope conformation during vaccine production and storage

  • Structure-guided adjuvant selection:

    • Understanding protein structure helps predict how different adjuvants might interact with the antigen

    • This can guide selection of adjuvants that preserve critical epitopes
      The successful structural determination of a leptospiral ABC ATPase demonstrates that obtaining structural information on Leptospira proteins is feasible, though membrane proteins like atpF present additional challenges.

What are the specific challenges in developing site-directed mutations in atpF to study its function?

Creating and analyzing site-directed mutations in atpF presents several technical challenges:

  • Identifying critical residues:

    • Limited structural information on Leptospira atpF necessitates reliance on homology models

    • Functional residues must be predicted based on conservation analysis

    • Successful examples include identification of H98 in Hklep and D53 in Rrlep as phosphorylation sites

  • Genetic manipulation challenges:

    • Lower transformation efficiency in Leptospira compared to model organisms

    • Need for selective markers that function in Leptospira

    • Slower growth rates, especially for pathogenic species, extending experimental timelines

  • Phenotype detection:

    • Subtle phenotypes may be difficult to detect

    • Need for sensitive assays to measure ATP synthesis rates

    • Requirement for controlled growth conditions to reveal conditional phenotypes

  • Membrane protein expression issues:

    • atpF mutations may destabilize the entire ATP synthase complex

    • Distinguishing direct from indirect effects requires careful control experiments

    • Complementation systems needed to verify phenotype restoration

  • Technical solutions:

    • Site-directed mutagenesis protocols similar to those used for Hklep/Rrlep

    • In vitro assays using purified components, as demonstrated with ABC ATPase phosphorylation studies

    • Structural validation using techniques proven successful with Leptospira proteins
      The successful use of site-directed mutagenesis to study the Hklep/Rrlep two-component system provides a methodological framework that could be applied to atpF .

How might systems biology approaches advance our understanding of atpF in Leptospira energy metabolism?

Systems biology offers powerful approaches to understand atpF within the broader context of Leptospira metabolism:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation of atpF expression with other energy metabolism components

    • Network analysis to position atpF within metabolic pathways

  • Computational modeling:

    • Generation of genome-scale metabolic models including ATP synthase components

    • Flux balance analysis to predict the impact of atpF modifications

    • Comparison between saprophytic and pathogenic Leptospira models

  • Regulatory network mapping:

    • Identification of transcription factors controlling atpF expression

    • Integration with known regulatory systems like Hklep/Rrlep

    • Analysis of coordinated regulation with other energy metabolism genes

  • Evolutionary analysis:

    • Comparative genomics across Leptospira species

    • Identification of selective pressures on ATP synthase components

    • Correlation with habitat transitions (environmental vs. host-adapted lifestyles)
      The research on ABC ATPases involved in metal utilization and two-component systems regulating heme biosynthesis provides valuable datasets that could be integrated into a systems biology framework to better understand energy metabolism regulation in Leptospira.

What role does atpF play in Leptospira antibiotic susceptibility and resistance mechanisms?

ATP synthase components, including atpF, may influence antibiotic susceptibility through several mechanisms:

  • Direct antibiotic targets:

    • Some antibiotics (e.g., bedaquiline for Mycobacterium) directly target ATP synthase

    • Structural variations in atpF could affect binding of such compounds

    • Understanding atpF structure could enable development of Leptospira-specific ATP synthase inhibitors

  • Energy-dependent resistance mechanisms:

    • Many antibiotic resistance mechanisms require ATP (e.g., efflux pumps)

    • Mutations affecting ATP synthase efficiency could modulate these energy-dependent processes

    • This relationship has been observed in other bacterial species but remains unexplored in Leptospira

  • Membrane potential and antibiotic uptake:

    • ATP synthase function affects membrane potential

    • Many antibiotics require specific membrane potential for uptake

    • atpF mutations could alter membrane properties affecting antibiotic penetration

  • Metabolic state and antibiotic efficacy:

    • Energy production affects growth rate and metabolic state

    • Many antibiotics are more effective against actively growing cells

    • ATP synthase modifications could create persister-like states with reduced antibiotic susceptibility

  • Experimental approaches:

    • MIC determination for atpF mutants against various antibiotic classes

    • Time-kill kinetics under different metabolic conditions

    • Correlation of ATP synthesis rates with antibiotic susceptibility Understanding these relationships could guide development of combination therapies targeting both ATP synthesis and other cellular processes for more effective Leptospira treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.