Recombinant Leptospira biflexa serovar Patoc Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

Recombinant Leptospira biflexa serovar Patoc Cobalamin Synthase (CobS) is a bacterial enzyme involved in cobalamin (vitamin B12) biosynthesis. CobS catalyzes the final steps of cobalamin assembly, transferring the adenosyl group to the corrin ring and facilitating the attachment of the lower ligand during vitamin B12 synthesis . This recombinant protein is expressed in Escherichia coli with an N-terminal His tag for purification and research applications .

Table 1: Key Features of Recombinant CobS

ParameterDetails
Source OrganismLeptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
Expression SystemE. coli
Protein LengthFull-length (1–275 amino acids)
Molecular Weight~23 kDa (predicted from amino acid sequence)
Purity>90% (SDS-PAGE analysis)
TagN-terminal His tag
StorageLyophilized powder at -20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionTris/PBS-based buffer with 6% trehalose (pH 8.0); add glycerol for long-term storage

Applications in Research

Recombinant CobS is primarily utilized for:

  • Enzyme Activity Studies: Investigating cobalamin biosynthesis pathways in Leptospira spp. .

  • Structural Biology: Analyzing protein-ligand interactions due to its role in vitamin B12 synthesis .

  • Antigen Production: Generating antibodies for diagnostic or functional studies targeting Leptospira metabolism .

Table 2: Expression Systems for Recombinant CobS

FeatureCreative Biomart Cusabio
Expression VectorE. coli with His tagE. coli with His tag
Protein FormLyophilized powderLyophilized powder
Purity>90% (SDS-PAGE)>85% (SDS-PAGE)
Storage BufferTris/PBS + 6% trehaloseTris/PBS + 6% trehalose
Reconstitution AdviceAdd 5–50% glycerol for stabilityAdd 5–50% glycerol for stability

Research Context and Findings

  • Genetic Regulation: In Leptospira biflexa, the cobS gene (UniProt ID: B0SFE6) is part of a conserved metabolic network linked to heme biosynthesis . Mutations in related two-component systems (e.g., Hklep/Rrlep) disrupt heme metabolism, suggesting CobS may interact with broader regulatory pathways .

  • Evolutionary Insights: Comparative genomics reveals cobS homologs in pathogenic Leptospira spp., underscoring its conserved role in bacterial survival .

  • Biotechnological Utility: Heterologous expression strategies (e.g., CRISPR/Cas9 systems) developed for L. biflexa enable efficient production of recombinant proteins like CobS for functional studies .

Challenges and Future Directions

  • Functional Characterization: The enzymatic kinetics and substrate specificity of CobS remain underexplored .

  • Pathogenic Relevance: While CobS is critical for saprophytic L. biflexa, its role in pathogenic Leptospira spp. requires further investigation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your requirement when placing the order and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing the specified tag.
Synonyms
cobS; LEPBI_I2939; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
Target Names
cobS
Target Protein Sequence
MKYILLEIRLFFVCMSFLTRIPSPRWIGFQEEWLHHSIKYSPSVGFLLGSLQWFVFLLFQ FLFGPTIAFTISLGFLLILTGAFHEDGFSDFCDGIGGGWKREDILRIMKDSRVGSFGAAG ISLLLLLKVLGVSETFHQYEIKGLPFTFGSSAQIHLLSVWLYFVTAQSFSRFLSILMMKL LPYAKEEGYAKPMAKEINWPQIYFACIFGVTPFLALVYLHPYFLLSLLCIIPSFVYMFSL MKRWIQGFTGDCLGAVQQVVETCIWISGVFVWISI
Uniprot No.

Target Background

Function
Cobalamin synthase (CobS) from Leptospira biflexa serovar Patoc catalyzes the formation of adenosylcobalamin (Ado-cobalamin) by joining adenosylcobinamide-GDP and alpha-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Leptospira biflexa and why is it used as a model organism?

Leptospira biflexa is a non-pathogenic, saprophytic species of the genus Leptospira that serves as an important model organism in leptospiral research. It offers significant advantages over pathogenic species, including faster in vitro growth rates and more amenable genetic manipulation systems. Techniques such as targeted allelic exchange, transposon mutagenesis, conjugative transfer, fluorescent markers, and inducible promoter systems were first developed in L. biflexa before being adapted for pathogenic Leptospira species . Despite these advantages, there are still knowledge gaps regarding the L. biflexa proteome that limit its utility for certain studies . The saprophyte L. biflexa serovar Patoc is particularly valuable as a surrogate host for expressing genes from pathogenic leptospires to investigate their functions .

What is Cobalamin synthase (cobS) and what is its function?

Cobalamin synthase (cobS) is an enzyme involved in the biosynthesis of adenosylcobalamin (vitamin B12). In Salmonella typhimurium, cobS has been identified as the enzyme that catalyzes the attachment of α-ribazole-5′-phosphate to adenosylcobinamide-GDP, forming adenosylcobalamin-5′-phosphate . This reaction is a critical step in the nucleotide loop assembly pathway of cobalamin biosynthesis. Specifically, CobS functions as the cobalamin(-5′-phosphate) synthase, as demonstrated by in vitro reactions where adenosylcobalamin−5′-phosphate was isolated from reaction mixtures containing adenosylcobinamide-GDP and α-ribazole-5′-phosphate in the presence of purified CobS . While the cobS function has been well-characterized in S. typhimurium, its expression and activity in Leptospira species remains an area of active research interest.

How can heterologous expression of proteins be achieved in Leptospira biflexa?

Heterologous expression in L. biflexa typically utilizes specialized vectors and strong promoters. The pMaOri vector system has been successfully employed for heterologous expression in L. biflexa . For promoters, the lipL32 promoter (P32) has proven particularly effective, as it's a strong promoter that drives high-level expression of target proteins . In one documented example, the pathogen-specific leptospiral protein LIC11711 was successfully expressed in L. biflexa under regulation of the P32 promoter, with expression confirmed using Western blotting . This approach resulted in higher protein expression levels in the recombinant L. biflexa compared to the native expression in pathogenic L. interrogans . The heterologous expression system should include appropriate controls, such as L. biflexa transformed with an empty vector, to account for any vector-related effects.

What are the optimal culture conditions for working with recombinant Leptospira biflexa?

Optimal cultivation of L. biflexa requires specific conditions for successful growth and protein expression. Cultures should be maintained in EMJH medium supplemented with 50 mg/liter MgCl₂·7H₂O and any necessary antibiotics for plasmid maintenance . Incubation should be conducted at 30°C with shaking at 150 rpm . For experimental work, exponential-phase cells should be harvested at approximately 5 × 10⁸ cells/ml, while stationary phase is reached at cell densities of ≥2 × 10⁹ cells/ml (typically 24 hours later) . Cell density can be accurately determined using a Petroff-Hausser counting chamber under dark-field microscopy . Proper culture maintenance is critical for ensuring consistent expression of recombinant proteins and reproducible experimental results.

How can successful expression and localization of recombinant proteins be verified in Leptospira biflexa?

Verification of recombinant protein expression and localization in L. biflexa requires multiple complementary approaches. Western blotting is a primary method for confirming protein expression, as demonstrated with LIC11711 expression, where a ~23-kDa band was detected in recombinant L. biflexa lysates . To determine cellular localization, cellular fractionation techniques can separate soluble and membrane-associated proteins. This can be accomplished by lysing cells using a French pressure cell (16,000 lb/in²) followed by ultracentrifugation at 100,000 × g at 4°C for 1 hour . For surface-exposed proteins, immunofluorescence or protease accessibility assays may provide additional localization evidence. When studying LIC11711, cellular localization assays confirmed its surface-exposed nature, consistent with its function . Additionally, functional assays specific to the protein of interest provide the ultimate verification of successful expression of a properly folded, active protein.

How can recombinant Leptospira biflexa be used to study functions of pathogen-specific proteins?

Recombinant L. biflexa serves as a powerful tool for investigating the functions of pathogen-specific proteins in a non-pathogenic background. This approach has been successfully demonstrated with the expression of LIC11711 from L. interrogans in L. biflexa, which revealed its role in virulence mechanisms . The heterologous expression of LIC11711 in L. biflexa enhanced the bacteria's ability to adhere to host components like laminin and plasminogen/plasmin, suggesting its involvement in bacterial pathogenesis . This gain-of-function approach allows researchers to observe how individual pathogen-specific proteins contribute to virulence-associated phenotypes without the complications of working with pathogenic organisms. The transformed L. biflexa gained specific functions that are normally associated with pathogenic leptospires, demonstrating that this approach can effectively identify and characterize virulence factors .

What methods can be used to measure the functional activity of recombinant Cobalamin synthase?

Functional activity of recombinant cobS can be assessed using established biochemical assays. Based on methods developed for S. typhimurium cobS, a complete reaction mixture would contain adenosylcobinamide-GDP, α-ribazole-5′-phosphate, an appropriate buffer (such as Ches buffer, pH 9), MgCl₂, and the recombinant enzyme . Reactions can be stopped by adding KCN and heating at 80°C for 10 minutes . Products can be detected using either bioassays or chromatographic methods. For quantitative analysis, assays can be performed using radioactively labeled substrates (such as [¹⁴C]α-ribazole-5′-P), with products separated by thin-layer chromatography on polyethyleneimine cellulose plates developed with 0.1 M potassium phosphate (pH 8.0) containing 10 mM KCN . Product formation can then be quantified using phosphorimaging techniques .

How do post-translational modifications affect protein function in Leptospira biflexa?

Post-translational modifications play significant roles in protein function in L. biflexa and show distinct patterns in different cellular fractions. Research has revealed that methylation and acetylation of lysine residues occur predominantly in membrane-associated proteins, while phosphorylation is detected mainly among soluble proteins in L. biflexa . These modification systems appear to be conserved between saprophytic L. biflexa and pathogenic Leptospira species, suggesting they provide important physiological advantages despite the different lifestyles of these species . For recombinant proteins expressed in L. biflexa, these native post-translational modification systems may impact protein folding, localization, stability, and function. Understanding these modifications is crucial when using L. biflexa as an expression system, as the presence or absence of appropriate modifications may affect the activity of the recombinant protein.

What controls should be included when working with recombinant Leptospira biflexa?

Proper experimental design with appropriate controls is essential when working with recombinant L. biflexa. Key controls include:

Control TypePurposeExample Application
Wild-type L. biflexaBaseline comparisonUsed to distinguish effects of vector backbone from effects of the expressed protein
L. biflexa with empty vectorVector effects controlIn LIC11711 studies, L. biflexa-pMaOri served as control for L. biflexa-LIC11711
Protein expression controlVerify expressionDnaK (~70-kDa) used as experimental control in Western blots
Functional negative controlSpecificity validationFor adhesion assays, BSA can serve as a negative binding substrate
Positive control strainFunctional comparisonPathogenic L. interrogans provides comparison for gain-of-function studies

When studying LIC11711 expression, researchers used L. biflexa-pMaOri (containing the empty vector) as a control to compare with L. biflexa-LIC11711, allowing them to attribute functional differences specifically to the expressed protein rather than to vector effects . Additionally, monitoring expression of constitutive proteins like DnaK can serve as loading controls for protein analysis .

What challenges might arise when expressing recombinant Cobalamin synthase in Leptospira biflexa?

Several challenges may complicate the expression of recombinant cobS in L. biflexa:

  • Protein folding and stability: As with any heterologous expression system, ensuring proper protein folding is crucial. CobS requires correct folding to maintain its enzymatic activity.

  • Post-translational modifications: L. biflexa has distinct patterns of post-translational modifications for membrane and soluble proteins . If cobS requires specific modifications for activity, these may differ between the native host and L. biflexa.

  • Cellular localization: Proper subcellular targeting is essential for protein function. Techniques for cellular fractionation, as described for L. biflexa proteome analysis, can help determine protein localization .

  • Expression level optimization: While strong promoters like P32 enhance expression, overexpression may lead to inclusion body formation or toxicity. The P32 promoter significantly increased LIC11711 expression in L. biflexa compared to native levels in L. interrogans .

  • Substrate availability: For functional studies, ensuring availability of cobS substrates (adenosylcobinamide-GDP and α-ribazole-5′-phosphate) within L. biflexa may be challenging.

How can the in vitro cobS assay system be adapted for studying recombinant Leptospira biflexa cobS?

The established in vitro cobS assay system developed for S. typhimurium can be adapted for studying recombinant L. biflexa cobS with several modifications:

  • Substrate preparation: Adenosylcobinamide-GDP and α-ribazole-5′-phosphate substrates may need to be synthesized or purified as described for the S. typhimurium system .

  • Reaction conditions: The optimal buffer, pH, temperature, and ion concentrations may differ for L. biflexa cobS compared to S. typhimurium cobS. Initial experiments should use conditions established for S. typhimurium (Ches buffer, pH 9; MgCl₂) with subsequent optimization .

  • Protein extraction: Cellular fractionation techniques developed for L. biflexa proteome analysis can be applied to isolate recombinant cobS from appropriate cellular compartments .

  • Detection methods: Product detection can utilize similar approaches to those established for S. typhimurium cobS, including bioassays, TLC separation (Rf values of 0.33 for α-ribazole-5′-P and 0.43 for CNCbl-5′-P), and phosphorimaging quantitation for radioactively labeled substrates .

  • Functional validation: Growth complementation assays using cobalamin auxotrophs can provide functional evidence of cobS activity in addition to biochemical assays .

What insights might recombinant Leptospira biflexa expressing cobS provide about cobalamin metabolism in pathogenic Leptospira?

Recombinant L. biflexa expressing cobS could reveal important aspects of cobalamin metabolism in leptospires. By comparing the function and regulation of cobS between saprophytic and pathogenic species, researchers may uncover differences related to their distinct ecological niches. The heterologous expression approach has already proven valuable for other proteins; for example, expressing LIC11711 in L. biflexa demonstrated its role in adhesion to host components and plasminogen acquisition, functions critical for pathogenesis . Similarly, studying cobS function in this system could reveal whether cobalamin metabolism plays a role in leptospiral virulence or environmental adaptation. This approach aligns with the established value of L. biflexa as a surrogate host to describe the role of crucial virulence factors in pathogenic Leptospira species .

How does the study of recombinant cobS expression contribute to understanding bacterial evolution?

Studying cobS expression across bacterial species provides valuable evolutionary insights. Cobalamin biosynthesis represents one of the most complex biosynthetic pathways in bacteria, requiring approximately 30 enzymatic steps. The comparison of cobS function between different bacterial species (e.g., L. biflexa versus S. typhimurium) can reveal how this pathway has evolved and diverged. Notably, despite their different lifestyles, L. biflexa and pathogenic Leptospira species share conserved post-translational modification systems, suggesting important physiological advantages . The CobU, CobS, CobT, and CobC proteins that catalyze the late steps in adenosylcobalamin biosynthesis in S. typhimurium may have homologs with similar or divergent functions in Leptospira species. Understanding these evolutionary relationships could provide insights into bacterial adaptation strategies and the conservation of essential metabolic pathways across diverse bacterial lineages.

What future research directions could build upon recombinant Leptospira biflexa cobS studies?

Several promising research directions could emerge from studies of recombinant L. biflexa expressing cobS:

  • Comparative enzymology: Detailed biochemical characterization comparing cobS from saprophytic and pathogenic Leptospira species could reveal adaptations specific to each lifestyle.

  • Metabolic engineering: Building on successful heterologous expression, researchers could reconstruct complete cobalamin biosynthesis pathways in L. biflexa to study pathway regulation and intermediates.

  • Structural biology: Purification of recombinant cobS could enable structural studies to elucidate the molecular basis of its catalytic activity.

  • Host-pathogen interactions: If cobalamin metabolism influences virulence, recombinant L. biflexa expressing cobS could be used to study specific aspects of this relationship in a safer model system.

  • Synthetic biology applications: The well-characterized L. biflexa expression system could be expanded to create biocatalysts for producing cobalamin derivatives for research purposes.

The heterologous expression of pathogen-specific proteins in L. biflexa has already demonstrated value in identifying virulence factors, as exemplified by the LIC11711 studies . This approach offers a powerful platform for continued exploration of leptospiral biology and the development of new tools and strategies to combat leptospirosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.