Recombinant Leptospira biflexa serovar Patoc NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Leptospira biflexa Serovar Patoc NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Leptospira biflexa serovar Patoc nuoK is a heterologously expressed protein derived from the saprophytic bacterium Leptospira biflexa, a model organism for studying pathogenic Leptospira species. It is a subunit of NADH-quinone oxidoreductase (Complex I), a key component of bacterial electron transport chains responsible for ATP synthesis. This protein is produced in E. coli with an N-terminal His-tag for purification and structural studies .

Primary Sequence and Domains

The full-length protein (1–106 amino acids) shares identical sequences across multiple commercial preparations, with the primary sequence:
MNQIINGIPVTYILGLAGILFSIGVLGVLIRRNIVIIFMSVELILNSVNLVFVTFSKALS HINGETIVFFVMAIAAAEAAVGLALVIAIFRHKKSTNVDELQSMKW .
Key features include:

  • Transmembrane topology: Classified as a transmembrane protein, suggesting involvement in membrane-associated processes .

  • Function: Part of Complex I, which catalyzes the transfer of electrons from NADH to ubiquinone .

ParameterValue
UniProt IDB0SP90 (LEPBI_I1304) or B0SFU2 (LBF_1250)
Gene NamenuoK
Expression SystemE. coli
TagN-terminal 10xHis-tag
Purity>85–90% (SDS-PAGE)
Molecular Weight~12 kDa (predicted)
SolubilityLyophilized powder in Tris/PBS buffer with 6% trehalose, pH 8.0

Reconstitution and Handling

  • Reconstitution: Dissolve in deionized sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Storage: Aliquot and store at -20°C/-80°C to avoid repeated freeze-thaw cycles .

Experimental Utility

  • Immunoassays: Used as an antigen in ELISA kits for detecting anti-nuoK antibodies .

  • Western blotting: Serves as a control for protein expression studies in Leptospira research .

  • Heterologous expression: L. biflexa is employed as a surrogate host to study pathogenic Leptospira proteins, though nuoK itself has not been directly linked to virulence .

Contextual Insights from L. biflexa Studies

Study FocusKey FindingsRelevance to nuoK
Surface proteomicsL. biflexa membrane proteins undergo methylation/acetylation .Potential PTMs on nuoK remain uncharacterized.
Heterologous expressionL. biflexa overexpresses pathogenic Leptospira genes (e.g., lic11711) .nuoK’s utility in similar systems is unexplored.
Electron transport chainComplex I is critical for bacterial survival under stress .nuoK’s role in metabolic adaptation is inferred.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
nuoK; LBF_1250; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Target Names
nuoK
Target Protein Sequence
MNQIINGIPVTYILGLAGILFSIGVLGVLIRRNIVIIFMSVELILNSVNLVFVTFSKALS HINGETIVFFVMAIAAAEAAVGLALVIAIFRHKKSTNVDELQSMKW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transport from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. This process couples the redox reaction to proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links

KEGG: lbf:LBF_1250

Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Leptospira biflexa serovar Patoc and its significance in research?

Leptospira biflexa is a free-living saprophytic spirochete commonly found in aquatic environments. As the first saprophytic Leptospira to be fully sequenced, it serves as an excellent model organism for studying Leptospira evolution and basic bacterial processes. The genome of L. biflexa contains 3,590 protein-coding genes distributed across three circular replicons: a main 3,604 kb chromosome, a smaller 278-kb replicon also carrying essential genes, and a third 74-kb replicon . L. biflexa serovar Patoc is particularly valuable as a surrogate system for heterologous expression of genes from pathogenic Leptospira species, allowing researchers to study virulence factors in a non-pathogenic background .

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Leptospira biflexa?

NADH-quinone oxidoreductase subunit K (nuoK) in Leptospira biflexa is a component of Complex I of the respiratory chain. This complex catalyzes the transfer of electrons from NADH to quinones, coupled with proton translocation across the membrane. The nuoK subunit is membrane-embedded and contributes to the proton-pumping mechanism of the complex. Comparative genomic analysis suggests that energy metabolism genes like nuoK represent part of the progenitor genome that existed before divergence of pathogenic and saprophytic Leptospira species, with approximately 61% of L. biflexa genes being part of this core ancestral genome .

How does the genome organization of L. biflexa differ from pathogenic Leptospira species?

L. biflexa has several distinguishing genomic features compared to pathogenic Leptospira species. Nearly one-third of L. biflexa genes are absent in pathogenic Leptospira, suggesting significant genomic divergence. Unlike pathogenic species, L. biflexa shows minimal genome rearrangement after lateral gene transfer, likely due to high gene density and limited presence of transposable elements. In contrast, pathogenic Leptospira genomes (like L. borgpetersenii and L. interrogans) undergo frequent rearrangements, often involving recombination between insertion sequences. L. biflexa also possesses enhanced environmental sensing capacities compared to pathogenic species, particularly L. borgpetersenii, which has lost many signal transduction functions presumed to have impaired its survival outside mammalian hosts .

What expression systems are optimal for recombinant production of L. biflexa nuoK?

For recombinant production of L. biflexa nuoK, researchers have successfully employed both homologous and heterologous expression systems. For heterologous expression, E. coli-based systems using vectors like pET or pGEX with inducible promoters (such as T7 or tac) provide good yields. For homologous expression within Leptospira, the pMaOri vector system has proven effective, particularly when coupled with strong promoters like the lipL32 promoter (P32). This promoter has been demonstrated to enhance expression of target proteins in L. biflexa, as evidenced by its successful use in overexpressing the LIC11711 protein from pathogenic L. interrogans in L. biflexa .

What purification strategies yield the highest purity of recombinant L. biflexa nuoK?

Purification of membrane proteins like nuoK requires specialized approaches. A multi-step purification protocol typically begins with cell lysis by sonication or French press in the presence of protease inhibitors. Membrane fraction isolation by ultracentrifugation is followed by solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). Purification can be achieved through immobilized metal affinity chromatography (IMAC) when the protein contains a His-tag, followed by size exclusion chromatography (SEC) for higher purity. Western blotting using specific antibodies, as demonstrated with other Leptospira proteins, can confirm protein identity and purity. For quantitative analysis, normalization against housekeeping proteins like DnaK (~70-kDa) can serve as experimental controls .

How can researchers validate the correct folding and function of recombinant nuoK?

Validating correct folding and function of recombinant nuoK requires multiple complementary approaches. Circular dichroism (CD) spectroscopy can assess secondary structure elements typical of membrane proteins. Thermal shift assays using fluorescent dyes like SYPRO Orange can evaluate protein stability. Functional validation involves measuring NADH oxidation activity in reconstituted proteoliposomes or membrane preparations using spectrophotometric assays. Proton pumping activity can be assessed using pH-sensitive fluorescent dyes like ACMA (9-amino-6-chloro-2-methoxyacridine). Proper membrane integration can be confirmed through protease accessibility assays and subcellular fractionation followed by Western blotting, similar to methods used to confirm surface localization of other leptospiral proteins like LIC11711 .

What evolutionary insights can be gained from studying nuoK in the context of Leptospira speciation?

The nuoK gene provides valuable insights into Leptospira evolution and speciation. Comparative genomic analysis indicates that genes involved in core metabolism, including nuoK, are part of the approximately 2,052 genes (61% of the L. biflexa genome) that represent the progenitor genome existing before divergence of pathogenic and saprophytic Leptospira species. Phylogenetic analysis of nuoK sequences across Leptospira species can help reconstruct evolutionary relationships and identify selection pressures acting on respiratory chain components. The relative conservation of nuoK compared to more variable virulence-associated genes highlights the distinction between core metabolic functions and adaptations specific to pathogenic or environmental lifestyles. This evolutionary perspective helps researchers understand how metabolic capabilities have shaped Leptospira adaptation to different ecological niches .

How can researchers use heterologous expression systems to study nuoK function?

Heterologous expression systems provide powerful tools for studying nuoK function. Following the approach demonstrated with other Leptospira proteins, researchers can express nuoK in surrogate organisms like E. coli respiratory chain complex I mutants to assess functional complementation. For expression in L. biflexa, the pMaOri vector system under control of strong promoters like P32 (lipL32 promoter) has been shown to achieve high expression levels. Quantitative RT-PCR can confirm transcription levels, while Western blotting with specific antibodies can verify protein expression levels. Cellular localization can be confirmed through protease accessibility assays and immunofluorescence microscopy. This heterologous expression approach has been successfully used with other Leptospira proteins, such as LIC11711, where expression in L. biflexa confirmed its surface localization and functional properties .

What biophysical techniques are most informative for characterizing nuoK structure-function relationships?

Several biophysical techniques provide critical insights into nuoK structure-function relationships. Cryo-electron microscopy (cryo-EM) of purified Complex I can reveal nuoK's position and interactions within the larger respiratory complex. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify dynamic regions and solvent-accessible surfaces. Site-directed mutagenesis of conserved residues followed by functional assays can pinpoint catalytically important amino acids. Protein crosslinking combined with mass spectrometry can map interaction interfaces with other complex subunits. Molecular dynamics simulations based on structural data can model proton translocation mechanisms through nuoK's transmembrane domains. Together, these approaches enable researchers to develop comprehensive models of how nuoK contributes to the proton-pumping mechanism of the NADH-quinone oxidoreductase complex.

How can researchers overcome the challenges of working with membrane proteins like nuoK?

Working with membrane proteins like nuoK presents several challenges that require specialized approaches. For protein solubilization, researchers should systematically screen multiple detergents (DDM, LMNG, digitonin) at various concentrations to identify optimal extraction conditions that maintain native structure. Alternative solubilization methods using styrene-maleic acid copolymers (SMAs) or amphipols can preserve the native lipid environment. For recombinant expression, using specialized E. coli strains (C41/C43 or Lemo21) designed for membrane protein production can improve yields. Including fusion partners like MBP or SUMO can enhance folding and solubility. For structural studies, reconstitution into nanodiscs or lipid cubic phase can stabilize the protein for cryo-EM or crystallography attempts. These approaches have proven effective for other membrane proteins and can be adapted for nuoK research.

What strategies help resolve data contradictions in nuoK functional studies?

Resolving data contradictions in nuoK functional studies requires systematic troubleshooting and experimental refinement. When activity assays yield inconsistent results, researchers should standardize protocols across laboratories, including detailed buffer compositions, temperature controls, and substrate quality verification. Multiple complementary functional assays should be employed to distinguish between direct and indirect effects of nuoK modification. When genetic manipulation produces conflicting phenotypes, researchers should verify strain backgrounds, exclude polar effects on adjacent genes, and confirm expression levels of compensatory proteins. Contradictions between in vitro and in vivo findings may reflect different lipid environments or interacting partners, requiring reconstitution experiments with native lipids. Combining biochemical, genetic, and structural approaches provides the most robust resolution to data contradictions.

How can advanced imaging techniques enhance nuoK localization and interaction studies?

Advanced imaging techniques significantly enhance nuoK localization and interaction studies. Super-resolution microscopy methods like STORM or PALM can visualize nuoK distribution with nanometer precision, revealing clustering patterns within the bacterial membrane. Correlative light and electron microscopy (CLEM) can connect functional observations with ultrastructural context. Proximity labeling approaches using engineered peroxidases (APEX) or biotin ligases (TurboID) fused to nuoK can identify neighboring proteins in the native cellular environment. Förster resonance energy transfer (FRET) between nuoK and other complex subunits can measure interaction distances in living cells. For tracking dynamic associations, fluorescence recovery after photobleaching (FRAP) can measure nuoK mobility within membranes. These techniques complement traditional biochemical approaches and provide spatial context for functional data.

How does studying nuoK contribute to our understanding of Leptospira metabolism and adaptation?

Studying nuoK provides critical insights into Leptospira metabolism and adaptation strategies. As a component of respiratory Complex I, nuoK functions in energy conservation pathways essential for both saprophytic and pathogenic species. Comparative analysis of nuoK across Leptospira species reveals how respiratory chain components have evolved during adaptation to different ecological niches. In saprophytic L. biflexa, which must survive in varied environmental conditions, nuoK likely contributes to metabolic flexibility. Genome analysis has revealed that L. biflexa possesses enhanced environmental sensing capacities compared to pathogenic species like L. borgpetersenii, which has lost many signal transduction functions. These genomic differences suggest that energy metabolism proteins like nuoK may function differently in free-living versus host-adapted contexts, potentially influencing how these bacteria respond to changing energy availability and environmental stressors .

What potential exists for using L. biflexa nuoK expression systems in biotechnology applications?

L. biflexa nuoK expression systems hold several biotechnological applications. The successful heterologous expression of proteins in L. biflexa using strong promoters like P32 (as demonstrated with LIC11711) establishes a platform for expressing and studying difficult membrane proteins . This expression system could be adapted for production of other respiratory complex components or membrane proteins of medical or industrial interest. L. biflexa's natural adaptation to aquatic environments makes it potentially useful for developing bioremediation tools targeting water contaminants. Additionally, as a non-pathogenic surrogate for studying pathogenic Leptospira proteins, L. biflexa expression systems can facilitate vaccine antigen production and drug target validation without requiring high-containment facilities. The ability to express functional membrane proteins while maintaining their native conformation makes this system valuable for structural biology applications and antibody development.

How might comparative studies of nuoK inform vaccine or therapeutic development against pathogenic Leptospira?

Comparative studies of nuoK across Leptospira species can inform vaccine and therapeutic development through several avenues. While nuoK itself may not be an ideal vaccine candidate due to its conserved nature and membrane-embedded location, understanding respiratory chain organization helps identify metabolic vulnerabilities that could be targeted by novel therapeutics. Inhibitors specifically designed to interact with unique features of Leptospira nuoK could disrupt energy metabolism in pathogenic species. The heterologous expression system established in L. biflexa provides a valuable platform for expressing and characterizing potential drug targets from pathogenic Leptospira. Similar approaches have been successful with other proteins, such as LIC11711, where expression in L. biflexa confirmed its surface localization and interaction with host components like laminin and plasminogen, identifying it as a potential virulence factor .

What does systems biology analysis reveal about nuoK's role in the broader metabolic network of L. biflexa?

Systems biology approaches reveal nuoK's integration within L. biflexa's metabolic networks and regulatory circuits. Metabolic flux analysis using isotope labeling can quantify how nuoK activity influences carbon flow through central metabolism. Transcriptomic profiling under different growth conditions can identify co-regulated genes that function alongside nuoK in energy conservation pathways. Proteomics studies can map post-translational modifications of nuoK that might regulate its activity in response to environmental signals. Metabolomics analysis comparing wild-type and nuoK-modified strains can reveal metabolic bottlenecks and compensatory pathways activated when respiratory function is altered. These multi-omics approaches, when integrated through computational modeling, can predict how nuoK's function in electron transport couples with other metabolic modules to support L. biflexa's adaptation to changing environmental conditions.

How can cryo-electron microscopy advance our understanding of Leptospira respiratory complexes including nuoK?

Cryo-electron microscopy (cryo-EM) offers transformative potential for understanding Leptospira respiratory complexes. Single-particle cryo-EM of purified Complex I can resolve the position and structure of nuoK within the membrane domain at near-atomic resolution. Cryo-electron tomography of intact L. biflexa cells can visualize the native organization and distribution of respiratory complexes within the bacterial membrane. Subtomogram averaging can reveal higher-order associations between Complex I and other respiratory components. Time-resolved cryo-EM using microfluidic devices could potentially capture different conformational states during the catalytic cycle. These structural insights would illuminate how nuoK contributes to proton translocation and how the complex's architecture may differ between saprophytic L. biflexa and pathogenic Leptospira species, potentially revealing adaptations that support their distinct lifestyle requirements.

What experimental approaches can distinguish between the roles of nuoK in bioenergetics versus possible secondary functions?

To distinguish between nuoK's primary bioenergetic role and potential secondary functions, researchers can employ several sophisticated approaches. Conditional expression systems using tetracycline-responsive promoters can create partial loss-of-function phenotypes, revealing whether certain functions are more sensitive to nuoK levels than others. Separation-of-function mutations identified through comprehensive alanine scanning can disrupt specific activities while preserving others. Interactome mapping using proximity labeling or co-immunoprecipitation coupled with mass spectrometry can identify unexpected protein partners suggesting moonlighting functions. Metabolic bypass experiments, where alternative respiratory enzymes are expressed in nuoK-deficient strains, can determine whether phenotypes stem from energy deficiency or specific nuoK activities. Comparative phenotyping across diverse growth conditions can reveal context-specific functions not apparent under standard laboratory settings. Together, these approaches can delineate the full functional spectrum of nuoK beyond its canonical role in respiration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.