Recombinant Leptospira borgpetersenii serovar Hardjo-bovis UPF0316 protein LBL_2483 (LBL_2483)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
LBL_2483; UPF0316 protein LBL_2483
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Target Names
LBL_2483
Target Protein Sequence
MELNPGNPIFDYCVLPCFIFLARVTDVSIGTIRVILLTREKKVIAASLGFLEVLLWVIVI TQVIKNLNNALCYLAYAGGFAAGTFIGMILEEKLAIGFSLLRIISPRNGDEIANKLSEAG YGVTTMNGQGSRGPVKIVFTVLKRKKIGQAMTIVKSVEPDVFYSIENARSTNTAVSEDSP GLLRIGILEKILKVRK
Uniprot No.

Target Background

Database Links

KEGG: lbl:LBL_2483

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of LBL_2483 and how can it be effectively studied?

Recombinant Leptospira borgpetersenii serovar Hardjo-bovis UPF0316 protein LBL_2483 is a full-length protein consisting of 196 amino acids . For effective structural characterization, researchers should employ a multi-method approach beginning with computational structure prediction using AlphaFold2 or RoseTTAFold to generate initial models. These predictions should be followed by experimental validation using X-ray crystallography or cryo-electron microscopy. For challenging crystallization scenarios, consider nuclear magnetic resonance (NMR) spectroscopy for solution structure determination.

When expressing the protein for structural studies, the His-tagged version provides convenient purification options through immobilized metal affinity chromatography (IMAC) . The purified protein should undergo quality assessment using circular dichroism (CD) spectroscopy for secondary structure analysis and dynamic light scattering (DLS) to assess homogeneity before structural studies.

The integration of computational and experimental approaches provides the most comprehensive structural characterization, with each method addressing different aspects of protein structure.

What expression systems are most suitable for recombinant production of LBL_2483?

Based on available data, E. coli has been successfully used as an expression host for recombinant LBL_2483 production . When designing an expression strategy, consider the following methodological approach:

  • Optimize codon usage for E. coli expression by analyzing the GC content and rare codon frequency in the LBL_2483 sequence

  • Select an appropriate expression vector—pET systems with T7 promoters offer high-level expression, while pBAD vectors with arabinose-inducible promoters provide tighter regulation

  • Consider fusion partners like SUMO, MBP, or GST to enhance solubility if expression yields are low

  • Test different expression conditions by varying temperatures (15-37°C), induction times (2-24 hours), and inducer concentrations

The purification strategy should utilize the documented His-tag approach , with additional polishing steps like size exclusion chromatography to ensure high purity. Quality verification should include mass spectrometry to confirm molecular weight and SDS-PAGE to assess purity. For functional studies, ensure proper folding through activity assays or thermal shift assays.

How does LBL_2483 compare to other proteins in the UPF0316 family?

When comparing LBL_2483 to other UPF0316 family proteins, researchers should implement a systematic comparative genomics and proteomics approach. Begin with sequence alignment using tools like Clustal Omega or MUSCLE to identify conserved domains and motifs across the UPF0316 family. Calculate sequence identity and similarity percentages using matrix-based scoring systems (BLOSUM62 is recommended for divergent sequences).

Structural comparison should include superimposition of predicted or experimental structures using tools like PyMOL or UCSF Chimera, with RMSD values calculated for quantitative comparison. The following table outlines a typical comparison framework:

Analysis TypeMethodsExpected Outcomes
Sequence AnalysisMultiple sequence alignment, Conservation scoringIdentification of conserved residues and motifs
Structural Comparison3D structure superimposition, RMSD calculationStructural conservation patterns
Functional PredictionGenomic context analysis, Expression pattern comparisonPotential functional associations
Evolutionary AnalysisPhylogenetic tree construction, Selection pressure analysisEvolutionary relationships within the family

This systematic comparison will place LBL_2483 in its proper evolutionary and functional context within the UPF0316 family.

What is the predicted functional role of LBL_2483 in Leptospira borgpetersenii?

Predicting the functional role of LBL_2483 requires an integrated computational and comparative analysis approach. Begin with motif scanning using InterProScan and PFAM to identify conserved domains characteristic of UPF0316 family proteins. Apply protein function prediction algorithms that incorporate sequence, structure, and evolutionary information, such as DeepGOPlus or COFACTOR.

For pathogenicity assessment, compare presence and conservation across pathogenic and non-pathogenic Leptospira strains. Consider experimental validation of predictions using targeted approaches like those employed for LipL32 and LigA/LigB , such as CRISPRi-mediated knockdown followed by phenotypic characterization.

How can proteomic approaches be optimized for studying LBL_2483 interactions?

To optimize proteomic approaches for studying LBL_2483 interactions, researchers should implement a multi-faceted strategy. Begin with affinity purification coupled with mass spectrometry (AP-MS) using His-tagged LBL_2483 as bait. For increased specificity, consider proximity labeling techniques like BioID or APEX, where LBL_2483 is fused to a biotin ligase that biotinylates nearby proteins, enabling identification of transient interactions.

Cross-linking mass spectrometry (XL-MS) using reagents like DSS or EDC can capture direct protein-protein interactions by covalently linking proteins in close proximity before MS analysis. For detailed interaction mapping, employ hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions of LBL_2483 that show altered solvent accessibility upon binding partners.

Validate key interactions using complementary methods such as:

  • Co-immunoprecipitation for in vivo confirmation

  • Surface plasmon resonance (SPR) for quantitative binding parameters

  • Microscale thermophoresis (MST) for measuring interactions in solution

This comprehensive approach, similar to proteomic methods used to characterize LipL32 and LigA/LigB mutants , will provide a robust interactome map for LBL_2483.

What are the recommended protocols for analyzing LBL_2483 in animal models of leptospirosis?

For analyzing LBL_2483 in animal models of leptospirosis, adapt the methodological framework used for LipL32 and LigA/LigB studies . Begin with expression analysis: quantify lbl_2483 transcript levels using RT-qPCR and protein levels using Western blot with anti-His antibodies or custom anti-LBL_2483 antibodies across different infection stages.

For functional analysis, generate knockdown models using CRISPRi technology, which has been successfully applied to Leptospira . Design sgRNAs targeting the lbl_2483 promoter or early coding sequence, and validate knockdown efficiency by RT-qPCR and proteomics before animal studies.

The hamster model, as the gold standard for leptospirosis, should be implemented following this experimental workflow:

  • Infection with wild-type and LBL_2483 knockdown strains (n=4 per group minimum)

  • Daily monitoring of clinical parameters including weight loss, temperature, and disease-specific manifestations

  • Tissue collection upon reaching predetermined endpoints (4-21 days post-infection)

  • Bacterial burden analysis through quantitative culture methods with and without antibiotic selection to assess plasmid stability in vivo

  • Comparative proteomics between wild-type and LBL_2483 knockdown strains recovered from animal tissues

This approach mirrors the successful characterization of LipL32 mutants that identified 243 differentially expressed proteins during infection .

How can molecular dynamics simulations enhance our understanding of LBL_2483 function?

Molecular dynamics (MD) simulations offer powerful insights into LBL_2483 function through detailed analysis of its structural dynamics and interactions. Begin by developing a reliable structural model of LBL_2483 using homology modeling based on crystallized UPF0316 family proteins or AI-based structure prediction methods like AlphaFold2.

Prepare the system for simulation by defining a simulation box with explicit solvent (TIP3P water model recommended) and physiological ion concentration (0.15 M NaCl). Select an appropriate force field (AMBER ff14SB or CHARMM36m are suitable for bacterial proteins) and perform energy minimization followed by equilibration under constant temperature (310K) and pressure (1 atm).

Run production simulations for at least 100-500 ns to capture relevant conformational dynamics, with longer simulations (>1 μs) if exploring conformational changes. Analyze trajectories for:

  • Structural stability (RMSD, RMSF)

  • Conformational flexibility (principal component analysis)

  • Potential binding sites (pocket detection algorithms like POVME or MDpocket)

  • Electrostatic surface properties (APBS)

For mechanistic insights, perform in silico mutagenesis of conserved residues followed by additional simulations to assess functional impacts. Integration of MD results with experimental data will provide a mechanistic model of LBL_2483's molecular function.

What bioinformatic tools are most effective for predicting LBL_2483 functional domains?

For predicting functional domains in LBL_2483, implement a comprehensive bioinformatic workflow combining sequence-based, structure-based, and evolutionary approaches. The following table outlines the most effective tools and their applications:

Analysis CategoryRecommended ToolsApplication to LBL_2483
Sequence-based predictionInterProScan, HMMER, PFAMIdentification of conserved domains and motifs
Transmembrane topologyTMHMM, TOPCONS, PhobiusPrediction of membrane association
Signal peptidesSignalP-6.0, PrediSiIdentification of potential secretion signals
Structure-based predictionProFunc, COACHIdentification of structural motifs associated with function
Evolutionary conservationConSurfMapping conservation patterns onto 3D structure
Binding site predictionCOACH-D, SitePredictIdentification of potential interaction surfaces
Protein-protein interactionsmetaPPISP, ISPRED4Prediction of protein binding interfaces
Genomic contextSTRING, GeConT, FunCoupFunctional inference through genomic associations

Integrate these predictions using ensemble approaches like COFACTOR or DeepGOPlus that combine multiple features for improved accuracy. This multi-layered approach will provide robust predictions of functional domains within LBL_2483.

How should researchers approach conflicting findings regarding LBL_2483 function?

When confronting conflicting findings regarding LBL_2483 function, implement a systematic contradiction resolution framework. Begin with a structured literature review, categorizing contradictory claims according to the methodology outlined by Alamri and Stevenson . Create a comparison matrix documenting key experimental variables including:

  • Strain variations (different serovars of Leptospira borgpetersenii may express variant forms)

  • Expression systems (E. coli versus native expression)

  • Purification methods

  • Analytical techniques

  • Experimental conditions

Identify whether contradictions are direct (explicitly opposing claims) or indirect (differing interpretations of similar data). Evaluate methodological rigor using quality assessment tools like PRISMA for systematic reviews or ARRIVE for animal studies.

For experimental resolution, design studies that directly address contradictions by replicating conflicting experiments with controlled variables and expanded controls. Consider context-dependent functionality—proteins often serve different roles under different conditions, as seen with LipL32 exhibiting unexpected virulence effects in knockdown studies .

This comprehensive approach transforms apparent contradictions into opportunities for deeper understanding of LBL_2483's complex functionality.

What contextual factors might explain contradictory results in LBL_2483 studies?

Contradictory results in LBL_2483 studies likely stem from multiple contextual factors that should be systematically evaluated. Experimental design variations significantly impact outcomes: differences in bacterial strains (virulent versus attenuated Leptospira borgpetersenii), growth conditions (temperature, media composition, growth phase), and protein preparation methods (native versus recombinant, different tags ) can all alter results.

Technical variations in analytical methods—sensitivity differences between detection techniques, calibration standards, and data normalization approaches—may generate apparent contradictions from the same biological phenomenon. Biological context is crucial: LBL_2483 may exhibit different behaviors in different models (in vitro cell culture versus in vivo animal models ), and host factors like immune status can modify protein function.

When evaluating contradictions, examine incomplete reporting, where crucial experimental details may be omitted, making direct comparison impossible. Ontological inconsistencies—different definitions of "function" or "interaction"—can create semantic contradictions rather than biological ones.

To address these factors, implement reporting guidelines like ARRIVE for animal studies or MIAME for expression data. Create standardized protocols for LBL_2483 studies, similar to those developed for virulence factor assessment using CRISPRi .

How can meta-analysis techniques be applied to resolve contradictions in LBL_2483 literature?

To resolve contradictions in LBL_2483 literature through meta-analysis, implement a systematic methodology that extends beyond traditional statistical aggregation. Begin with comprehensive search strategies across multiple databases (PubMed, Scopus, Web of Science) using standardized MeSH terms and keywords including "LBL_2483," "Leptospira borgpetersenii," and "UPF0316 protein."

Apply the PRISMA protocol for systematic review with pre-registered inclusion/exclusion criteria. For data extraction, develop a standardized form capturing experimental details: protein preparation methods, experimental models, analytical techniques, and outcome measures. Assess study quality using domain-specific tools like SYRCLE for animal studies or QUADAS for diagnostic accuracy studies.

For quantitative synthesis, employ random-effects models that account for between-study heterogeneity, and conduct subgroup analyses based on methodological variations. Apply meta-regression to identify experimental factors that explain contradictory outcomes. For qualitative synthesis of mechanistic contradictions, use the context analysis framework described by Alamri to categorize contradictions as stemming from:

  • Different experimental contexts

  • Ontological differences

  • Genuine biological contradictions

This comprehensive meta-analytic approach transforms contradictory literature into a coherent understanding of context-dependent LBL_2483 functions and identifies knowledge gaps requiring targeted investigation.

How can CRISPRi be optimized for targeted silencing of LBL_2483 in Leptospira?

Optimizing CRISPRi for LBL_2483 silencing requires adapting the successful approach used for LipL32 and LigA/LigB knockdowns in Leptospira . Begin with strategic sgRNA design: generate multiple sgRNAs targeting the lbl_2483 promoter region and first 100 bases of the coding sequence using tools like CHOPCHOP or CRISPick with parameters adjusted for Leptospira's AT-rich genome.

For vector construction, use the validated pMaOri.dCas9 system that demonstrated high stability in vivo , but optimize the promoter driving dCas9 expression if LBL_2483 requires different expression kinetics than previously studied virulence factors. Transformation protocols should follow established electroporation methods for Leptospira, with optimization of DNA concentration and recovery times.

For validation, implement a tiered approach:

  • Measure transcript reduction via RT-qPCR

  • Confirm protein reduction via Western blot with anti-His antibodies (if using His-tagged LBL_2483 ) or custom antibodies

  • Assess knockdown specificity through whole-cell proteomics, comparing your results to the comprehensive proteomic analysis performed for LipL32 knockdowns that identified 243 differentially expressed proteins

For functional validation, measure phenotypic changes in vitro (growth rate, morphology, stress response) and in vivo using the hamster model with tissue analysis protocols developed for previous CRISPRi studies in Leptospira .

What are the advantages and limitations of using CRISPRi for LBL_2483 functional studies compared to traditional knockout methods?

CRISPRi offers distinct advantages for LBL_2483 functional studies that should be weighed against its limitations when compared to traditional knockout methods. The following table summarizes the key considerations:

AspectCRISPRi AdvantagesCRISPRi Limitations
Technical feasibilitySuccessfully applied to Leptospira Requires optimization for each target gene
Level of repressionTunable repression allows dose-response studiesIncomplete repression (70-95%) may mask phenotypes
Essential gene studiesViable for studying essential genesResidual expression may complicate interpretation
Temporal controlCan be inducible for stage-specific studiesInduction systems add complexity
In vivo stabilityHigh stability documented in animal models May vary between strains and experimental conditions
Off-target effectsMinimized with proper sgRNA designRequires comprehensive validation
System requirementsEpisomal system is technically simplerRequires antibiotic selection for maintenance

For definitive LBL_2483 characterization, consider combining CRISPRi with complementary approaches like heterologous expression or protein inhibition to address the limitations while leveraging the advantages of this technology.

How can researchers validate LBL_2483 knockdown efficiency in CRISPRi models?

Validating LBL_2483 knockdown efficiency in CRISPRi models requires a multi-level confirmation strategy similar to that used for LipL32 and LigA/LigB mutants . At the DNA level, confirm plasmid presence and stability using PCR targeting both dCas9 and the sgRNA cassette, with plasmid extraction and sequencing to verify construct integrity.

For RNA-level validation, perform RT-qPCR with primers spanning different regions of the lbl_2483 transcript, normalizing to validated reference genes for Leptospira (e.g., flaB or lipL41). Calculate repression efficiency as percentage reduction compared to control strains harboring non-targeting sgRNAs.

At the protein level, perform Western blotting using anti-His antibodies if using His-tagged LBL_2483 or develop custom antibodies against purified LBL_2483. Quantify band intensity using densitometry with appropriate loading controls.

For comprehensive validation, perform whole-cell proteomics comparing the knockdown strain to control strains, similar to the analysis performed for LipL32 mutants that identified 243 differentially expressed proteins . This will confirm on-target reduction of LBL_2483 and identify any off-target effects.

For in vivo validation, verify plasmid stability after animal passage by culturing leptospires from tissues with and without antibiotic selection . This comprehensive validation strategy ensures reliable interpretations of LBL_2483 knockdown phenotypes.

What interdisciplinary approaches can enhance LBL_2483 research?

Enhancing LBL_2483 research through interdisciplinary approaches requires strategic integration of diverse expertise and methodologies. Structural biology collaboration can provide atomic-resolution structures through X-ray crystallography, cryo-EM, or NMR spectroscopy, while computational biologists can apply molecular dynamics simulations to explore conformational dynamics and potential binding interactions.

Genomics partnerships enable comparative analysis across Leptospira strains to correlate LBL_2483 sequence variations with virulence phenotypes. Immunology collaborations can investigate host-pathogen interactions, particularly how LBL_2483 interfaces with host immune components—similar to studies revealing unexpected virulence properties of LipL32 .

Systems biology teams can integrate proteomic, transcriptomic, and metabolomic data to position LBL_2483 within broader pathogen response networks. Bioinformatics collaborations provide advanced sequence analysis, protein function prediction, and data integration through machine learning approaches.

Clinical microbiology partnerships connect basic research to clinical isolates and disease presentations. Synthetic biology teams can develop targeted tools for LBL_2483 manipulation, expanding on CRISPRi technologies successfully applied to Leptospira .

This interdisciplinary ecosystem transforms LBL_2483 research from isolated studies into a comprehensive understanding of its structural, functional, and pathogenic roles.

How can researchers effectively share LBL_2483 data and resources?

Effective sharing of LBL_2483 data and resources requires implementing a comprehensive research infrastructure that balances accessibility with proper attribution. For reagent sharing, deposit recombinant LBL_2483 constructs in nonprofit repositories like Addgene (for plasmids) or BEI Resources (for biological materials), with detailed protocols for expression and purification building upon documented E. coli expression systems .

Create standard operating procedures (SOPs) for LBL_2483 manipulation, including CRISPRi knockdown protocols adapted from successful Leptospira studies . For data sharing, utilize domain-specific repositories according to data type:

Data TypeRecommended RepositorySpecial Considerations
Protein StructuresProtein Data Bank (PDB)Include validation reports
Proteomics DataProteomeXchangeFollow minimal reporting standards
Genomics DataGenBankInclude detailed metadata
Functional AnnotationsUniProtKBLink to experimental evidence
Integrated DatasetsZenodo or DryadAssign DOI for citation tracking

Implement FAIR principles (Findability, Accessibility, Interoperability, Reusability) by using standardized metadata schemas and ontologies specific to Leptospira research. Consider pre-registration of LBL_2483 studies to address publication bias concerns identified in contradiction analysis research .

This infrastructure facilitates collaborative advancement of LBL_2483 research while ensuring proper credit allocation.

What funding opportunities are available for LBL_2483 research collaborations?

Funding opportunities for LBL_2483 research collaborations span multiple agencies and require strategic positioning of research questions. National Institutes of Health (NIH) offers several relevant mechanisms:

  • R01 grants for hypothesis-driven research on LBL_2483 function in leptospirosis pathogenesis

  • R21 grants for innovative, high-risk studies exploring novel functions

  • P01 program project grants for multi-investigator teams combining structural, functional, and pathogenesis studies

The NIH's National Institute of Allergy and Infectious Diseases (NIAID) specifically funds research on neglected tropical diseases including leptospirosis. National Science Foundation (NSF) funding is accessible through the Molecular and Cellular Biosciences (MCB) division for fundamental research on LBL_2483 structure and function.

International opportunities include the Wellcome Trust's collaborative awards for international teams, particularly relevant for neglected tropical diseases, and the European Commission's Horizon Europe program's health cluster. Foundations like the Bill & Melinda Gates Foundation support research on neglected diseases affecting developing countries.

For multi-disciplinary approaches, highlight connections to emerging technologies (CRISPRi applications ) or address contradictions in the literature to align with funding priorities emphasizing innovation and reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.