Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Apolipoprotein N-acyltransferase 1 (lnt1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

lnt1 is encoded by the lnt1 gene (also referred to as LIC_1124 or LA_1124 in genomic databases). It functions as an acyltransferase, potentially involved in modifying bacterial lipoproteins or surface components . The protein is expressed in recombinant formats, including full-length and partial variants, depending on the host system used.

Key Attributes:

  • Gene Synonyms: lnt1, LIC_1124, LA_1124

  • Protein Function: Apolipoprotein N-acyltransferase activity, likely involved in lipid metabolism or pathogen-host interactions.

  • Pathogenic Relevance: Expressed in virulent strains of L. interrogans serovar Copenhageni, a highly virulent serovar within serogroup Icterohaemorrhagiae .

Production and Recombinant Forms

lnt1 is produced via heterologous expression in diverse host systems, with variations in protein length and host compatibility. Below is a comparative analysis of recombinant lnt1 variants:

VariantHost SystemPuritySerovarProtein Length
Full-length lnt1Cell-free expression≥85% (SDS-PAGE)CopenhageniFull-length
Partial lnt1 (Copenhageni)E. coli, Yeast, Baculovirus, Mammalian Cell≥85% (SDS-PAGE)CopenhageniPartial
Partial lnt1 (Lai)E. coli, Yeast, Baculovirus, Mammalian Cell≥85% (SDS-PAGE)LaiPartial

Notes:

  • Full-Length vs. Partial: Full-length versions preserve the entire amino acid sequence, while partial variants exclude specific regions (e.g., N-terminal or C-terminal domains) .

  • Host System Impact: Cell-free systems enable rapid production without host contamination, whereas E. coli and mammalian cells are used for scalable or post-translational modification purposes .

Applications in Research and Diagnostics

Recombinant lnt1 is primarily used in biochemical and immunological assays:

  • Protein Purification: Served as a control in studies analyzing Leptospira protein interactions (e.g., LRR-protein binding assays) .

  • Antigen Production: Potential utility in developing serogroup-specific diagnostic tools, though no validated assays are reported .

Comparative Genomic Context

Genomic analyses of L. interrogans serovar Copenhageni reveal distinct features:

  • Conservation in Pathogenic Strains: lnt1 is absent in saprophytic Leptospira species (e.g., L. biflexa), highlighting its association with pathogenicity .

  • Divergence from Serovar Icterohaemorrhagiae: A frameshift mutation in lic12008 (LPS biosynthesis gene) distinguishes serovar Icterohaemorrhagiae from Copenhageni, though lnt1 remains conserved .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferred format during order placement, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly accompanied by normal blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest incorporating 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form, when stored under the same conditions, exhibits a shelf life of 12 months.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
While we strive to provide a suitable tag type during production, we welcome specific tag type requests. Please inform us of your preferred tag type, and we will prioritize its inclusion in the manufacturing process.
Synonyms
lnt1; LIC_12556; Apolipoprotein N-acyltransferase 1; ALP N-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-576
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
lnt1
Target Protein Sequence
MFYNFISKDSILYRLILCFGIGIGTVFGLSPFSFFSAGVFASISCIFLFFSLNRTSIWKA FLWLLILSQILNFTAFYWIPGAISRISGANTFVSILFFFLYGLISHLKFFLFYTLFRFSK IDSASKTYILLIFPAAGTLSDMITFQIFPWYWGNLISGSIVFEQFASICGVYGLSFLLLF ISSTFLILVNYYKYKNSKEFKTSIASLICIAFIYRFGLYRIGYINQSQNELKPKNLSVLM IQPDTSPGTKDLKADASYLSATMSKVFSLAIPTFENSPSLIVIPESAIPFHGTIDSEENR KEKIYSSTMEGIILYLSKHTGADVLFNELNLDENKLRNQVSLFKNLDGKTERYNKRRLLP FGEYLPMEKNFPFLRSIFQETSRYVPGEFPKLLIGNKIQNQRSFLPPEISKLNEPKTYRY EFSSIVEHTNKIRNLEYSYSILPLLCYEAMFTELVLDYFQNEQKPEVLINITNDSWFDSE LEAYQHSGAVRLRAIETGLPLIRSAVSGISEVWDARGIPMIVPIGFHETGTRAFSIRLDA IESTIYTRFGNSFLWIFCILILISRLIFVSRIERKS
Uniprot No.

Target Background

Function
This enzyme plays a crucial role in lipoprotein maturation by catalyzing the phospholipid-dependent N-acylation of the N-terminal cysteine residue of apolipoprotein, representing the final step in this process.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.