Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Apolipoprotein N-acyltransferase 2 (lnt2)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Pathogenic Role

The lnt2 gene (LIC_13250) is exclusive to pathogenic Leptospira species, absent in non-pathogenic strains like L. biflexa . Comparative genomic studies of serovars copenhageni and Icterohaemorrhagiae reveal:

  • Genetic Distinction: A frameshift mutation in the lic12008 gene distinguishes serovar Icterohaemorrhagiae from copenhageni, though both share >95% genomic similarity .

  • Virulence Association: Pathogenic Leptospira genomes encode numerous surface-exposed proteins, including lnt2, which may interact with host factors during infection .

Research Applications

Recombinant lnt2 is primarily used for:

  1. Structural Studies: Analyzing membrane protein folding and enzymatic activity .

  2. Antibody Production: Generating antisera to detect native lnt2 in pathogenic Leptospira strains .

  3. Pathogenesis Models: Investigating lipid metabolism’s role in bacterial survival and immune evasion .

Comparative Analysis with Other Recombinant Leptospira Proteins

ProteinFunctionDiagnostic/Vaccine UtilityReference
lnt2Lipid modificationUnder investigation
LigAHost cell adhesion100% survival in vaccinated hamsters
LipL32Outer membrane protein95% specificity in IgG ELISA
rChi2Multiepitope antigen75–82% sensitivity in early diagnosis

Challenges and Future Directions

Current limitations include incomplete data on lnt2’s interaction partners and immunogenicity. Future work should prioritize:

  • Functional assays to map enzymatic activity.

  • Immunization trials to assess protective efficacy.

  • Structural resolution via cryo-EM or X-ray crystallography .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lnt2; LIC_13250; Apolipoprotein N-acyltransferase 2; ALP N-acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
lnt2
Target Protein Sequence
MDTLHHRFQQFQKTIWFNIFCYLWTGIFSFLAFAPVSLTHFVWIAPFGFFWLSLKYHGKY KKLFFHGLLIGVVFYAISFHWIIHMAITFGNFPYVVAILILLFAGLLFGLKFPIFMMSFS FLSGKIGRHSVWVAGFCGLLSELIGPQLFPWYWGNLAAGNIILAQNAEITGVYGISFLVF IVSYTLFQSNPWHWKEIIHSKEKRKQYLRFITLPALLLLTFIVSGIFLFKKWENVKPVKS LNVLIVQPDAPLSFRDGREIKESIEALMARIEKLTDEGAVRLGKKPDLIVLPEAGVPFFS AHKTEITTKVRRMYWDRFDSLMFLLANRYKANVFFNEIDAGFKGAPSPRNLRYYNNNVLY DPNGDRRDSYQKKFLLMFGEYMPFDFLYELSQQTGRFEPGLTHNLIRYYTPRYYTLAEKE KSPKGRHLGWTDTETFNHEAVRSYYETTRTEVSETGKFLPLICYEVILPEFVREFRTAGN PEFIVNLTNDKWYGATTESDQHMELGRLRSIELRRWMVRSTNSGISANIDHLGRFVGNKK TGLMTAEALSETIDVIDSPPTFYTQYGNLIPWLMLFLTGIYYLNLLIGIRRGKSS
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase 2 (lnt2) and what is its role in Leptospira interrogans?

Apolipoprotein N-acyltransferase 2 (lnt2) is an integral membrane enzyme that catalyzes the third and final step of lipoprotein processing in Gram-negative bacteria, including Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni. The enzyme facilitates N-acylation of the terminal cysteine residue in apolipoproteins to form mature lipoproteins .

Specifically in Leptospira interrogans, lnt2 is part of the post-translational modification pathway that produces lipoproteins essential for bacterial envelope integrity and virulence. The mature lipoproteins generated through lnt2 activity contribute to pathogenesis by mediating interactions with host tissues and immune evasion mechanisms. The protein has a full length of 595 amino acids and functions as a membrane-associated enzyme .

How does lnt2 differ structurally and functionally from other proteins in Leptospira interrogans?

Lnt2 differs from other Leptospira interrogans proteins through its specific enzymatic function in lipoprotein processing. Unlike leucine-rich repeat (LRR) proteins such as LIC11051 and LIC11505 that directly interact with host components like GAGs and integrin receptors , lnt2 functions primarily in bacterial lipoprotein biosynthesis.

Structurally, lnt2 possesses multiple transmembrane domains that anchor it to the bacterial membrane, with catalytic domains positioned to interact with substrate lipoproteins. The protein contains a distinctive catalytic triad (likely including a cysteine residue) that forms a thioester acyl-intermediate during the reaction cycle, as observed in related Lnt enzymes . Unlike the LRR proteins that contain repeated leucine-rich motifs designed for protein-protein interactions, lnt2's structure is optimized for enzymatic catalysis.

What expression systems are most effective for producing recombinant lnt2?

Escherichia coli expression systems have proven effective for producing recombinant Leptospira interrogans lnt2 protein. The recombinant full-length protein (amino acids 1-595) can be successfully expressed with an N-terminal His-tag in E. coli . This approach yields protein that can be purified to greater than 90% purity as determined by SDS-PAGE analysis.

The expression protocol typically involves:

  • Cloning the lnt2 gene (complete coding sequence) into an appropriate expression vector with an N-terminal His-tag

  • Transformation into competent E. coli cells

  • Induction of protein expression under optimized conditions

  • Cell lysis and protein purification using affinity chromatography

  • Final processing into a lyophilized powder for storage stability

What conformational changes occur in lnt2 during catalysis, and how do they impact enzyme function?

Studies on related Lnt enzymes reveal significant conformational changes during the catalytic cycle. Crystal structures have captured different states of the enzyme, including:

  • An apo-state with an open substrate entry portal devoid of bound molecules

  • An acyl-intermediate state where a thioester bond forms between the enzyme and the acyl substrate

  • A potential apolipoprotein docking conformation

A particularly important conformational change involves tryptophan residue W237 (or its equivalent in lnt2), which appears to be triggered by substrate binding. This residue likely helps direct and stabilize the interaction between the enzyme and the incoming apolipoprotein substrate . The movement of this residue may represent a molecular switch that coordinates the sequential steps of catalysis.

These conformational states suggest a dynamic catalytic mechanism where substrate binding induces structural changes that optimize catalysis and product release, explaining the enzyme's ability to process diverse lipoprotein substrates.

How does the membrane environment affect lnt2 activity and stability in experimental systems?

The membrane environment significantly impacts lnt2 activity and stability, as it is an integral membrane enzyme with multiple transmembrane domains. Key considerations include:

  • Detergent selection: When extracting and purifying lnt2, the choice of detergent critically affects protein stability and activity. Mild detergents that maintain the native-like membrane environment are preferable.

  • Lipid composition: Reconstitution experiments may require specific phospholipids to support proper enzyme folding and function.

  • Membrane fluidity: Temperature-dependent membrane fluidity affects enzyme dynamics and substrate accessibility.

  • pH gradients: Transmembrane pH differences may influence enzyme conformation and catalytic efficiency.

For experimental design, it is recommended to test multiple detergent and lipid combinations when working with purified recombinant lnt2. Storage conditions should maintain the integrity of the membrane environment or suitable mimetic system to preserve enzymatic activity .

What are the kinetic parameters of lnt2 and how do they compare across different Leptospira strains?

While specific kinetic parameters for Leptospira interrogans lnt2 are not fully characterized in the provided literature, comparative analysis can be approached through the following methodology:

  • Express and purify recombinant lnt2 from different Leptospira strains using identical methods

  • Develop a standardized in vitro assay measuring N-acylation rates with standardized apolipoprotein substrates

  • Determine key parameters:

    • kcat (turnover number)

    • Km (substrate affinity)

    • Catalytic efficiency (kcat/Km)

Expected strain variations may correlate with pathogenicity. For instance, virulent strains like Leptospira interrogans strain Fiocruz L1-130 may exhibit different kinetic parameters compared to attenuated strains like M20 or saprophytic strains like L. biflexa . These differences could reflect evolutionary adaptations to different ecological niches and host interactions.

ParameterL. interrogans (virulent)L. interrogans (attenuated)L. biflexa (saprophytic)
Expression levelHighModerateLow/Variable
Substrate specificityNarrowIntermediateBroad
Catalytic efficiencyOptimized for host conditionsPartially adaptedNon-specialized

Note: This table represents hypothetical patterns based on observed expression patterns of other Leptospira proteins

What are the optimal conditions for expressing and purifying recombinant lnt2?

The optimal conditions for expressing and purifying recombinant Leptospira interrogans lnt2 involve specific parameters at each stage of the process:

Expression Conditions:

  • Vector system: pET-based vectors with T7 promoter systems typically yield high expression

  • E. coli strain: BL21(DE3) or derivative strains optimized for membrane protein expression

  • Induction: IPTG at 0.5-1.0 mM, induced at OD600 of 0.6-0.8

  • Temperature: Lower temperatures (16-18°C) post-induction may improve proper folding

  • Duration: Extended expression (16-20 hours) at reduced temperatures

Purification Protocol:

  • Cell lysis: Mechanical disruption combined with mild detergents

  • Initial extraction: Solubilization in buffer containing appropriate detergent (e.g., n-dodecyl-β-D-maltoside)

  • Affinity purification: Ni-NTA chromatography exploiting the N-terminal His-tag

  • Further purification: Size exclusion chromatography to remove aggregates

  • Buffer optimization: Tris/PBS-based buffer at pH 8.0 with 6% trehalose for stability

  • Storage: Lyophilization or storage at -80°C with glycerol (50%) as cryoprotectant

How can researchers effectively detect and quantify the activity of recombinant lnt2?

Detecting and quantifying lnt2 activity requires specialized assays that monitor the N-acylation of apolipoprotein substrates. Several complementary approaches can be employed:

1. Biochemical Activity Assays:

  • Radiolabeled substrate approach: Using [14C] or [3H]-labeled acyl donors to track transfer to apolipoprotein acceptors

  • Fluorescence-based assays: Employing fluorescently labeled substrate analogs with FRET-based detection

  • HPLC or mass spectrometry: To detect modified versus unmodified apolipoprotein substrates

2. Immunological Detection:

  • Western blotting: Using antibodies specific to lnt2 or the modified lipoproteins

  • ELISA-based quantification: For measuring concentrations of enzyme or product

  • Immunofluorescence microscopy: To visualize localization in bacterial cells

3. Advanced Analytical Methods:

  • Surface plasmon resonance (SPR): To study binding kinetics between lnt2 and substrates

  • Nuclear magnetic resonance (NMR): For studying structural changes during catalysis

  • Native mass spectrometry: To capture enzyme-substrate intermediates

When analyzing activity, researchers should control for:

  • Detergent concentration effects on enzyme function

  • Substrate presentation format (micelles, liposomes, etc.)

  • Product inhibition phenomena

  • Temperature and pH optima specific to leptospiral enzymes

What experimental approaches best elucidate the substrate specificity of lnt2?

Elucidating substrate specificity of Leptospira interrogans lnt2 requires systematic analysis of its interactions with different apolipoprotein substrates and acyl donors. Recommended experimental approaches include:

1. Substrate Library Screening:

  • Generate a diverse panel of synthetic apolipoprotein peptides with varying:

    • N-terminal sequences

    • Hydrophobic properties

    • Secondary structure elements

  • Test each substrate under standardized conditions and determine relative acylation rates

2. Structure-Activity Relationship Analysis:

  • Perform alanine-scanning mutagenesis of substrate peptides

  • Introduce specific modifications to substrate functional groups

  • Correlate structural features with catalytic efficiency

3. Comparative Analysis with Native Leptospira Lipoproteins:

  • Identify native lipoproteins from Leptospira proteomic analyses

  • Compare modification efficiency across different natural substrates

  • Analyze sequence and structural determinants of preferred substrates

4. Biochemical Competition Assays:

  • Use mixing experiments with multiple substrates to identify preferential activity

  • Determine IC50 values for different substrate variants

  • Establish hierarchy of substrate preference

These approaches should be integrated with structural analysis (e.g., crystallography or cryo-EM) to map substrate binding sites on lnt2 and identify key residues involved in substrate recognition, similar to approaches used for studying other Leptospira proteins like LIC11051 and LIC11505 .

How can researchers distinguish between active lnt2 and inactive protein in experimental samples?

Distinguishing active from inactive lnt2 in experimental samples requires multiple complementary approaches:

1. Activity-Based Protein Profiling:

  • Use chemical probes that specifically label active enzyme

  • Compare labeling intensity between fresh preparations and potentially degraded samples

  • Quantify active fraction through densitometry or fluorescence intensity

2. Structural Integrity Assessment:

  • Circular dichroism (CD) spectroscopy to monitor secondary structure

  • Thermal shift assays to assess protein stability

  • Limited proteolysis to detect conformational changes in misfolded protein

3. Direct Activity Assays:

  • Measure rate of thioester intermediate formation

  • Monitor product formation using standardized substrates

  • Compare with positive controls of known activity

4. Quality Control Methods:

  • Size-exclusion chromatography to detect aggregation

  • Dynamic light scattering to assess homogeneity

  • Native gel electrophoresis to detect oligomerization states

Reference Values for Quality Assessment:

ParameterAcceptable RangeInterpretation if Outside Range
Specific Activity>80% of reference standardPartial denaturation or inhibition
Thermal StabilityTm within ±2°C of referenceConformational changes or impurities
Monodispersity>90% monodisperseAggregation or oligomerization
Secondary StructureCD profile matching referenceMisfolding or domain destabilization

What are common pitfalls in lnt2 experimental design and how can they be avoided?

Common pitfalls in experimental work with Leptospira interrogans lnt2 include several challenges that can be avoided with careful experimental design:

1. Protein Insolubility and Aggregation:

  • Pitfall: Membrane proteins like lnt2 often aggregate during expression and purification

  • Solution: Optimize detergent type and concentration; consider fusion partners that enhance solubility; use lower expression temperatures

2. Loss of Activity During Purification:

  • Pitfall: Enzymatic activity decreases significantly during purification steps

  • Solution: Minimize purification steps; include stabilizing agents like glycerol or trehalose; maintain appropriate pH and ionic strength; consider purification under anaerobic conditions to prevent oxidation of catalytic cysteine

3. Substrate Presentation Issues:

  • Pitfall: Artificial substrate presentation that doesn't reflect native membrane environment

  • Solution: Use liposome reconstitution systems; test activity in nanodiscs or membrane mimetics; ensure proper orientation of substrate

4. Expression Host Limitations:

  • Pitfall: E. coli expression may yield protein lacking critical post-translational modifications

  • Solution: Consider alternative expression systems; verify protein function with complementation assays in Leptospira mutants

5. Assay Interference:

  • Pitfall: Components in the assay buffer interfere with activity measurements

  • Solution: Perform careful controls; validate assay robustness; test multiple detection methods

6. Cross-Reactivity in Immunological Detection:

  • Pitfall: Antibodies cross-react with other leptospiral proteins, particularly those with similar domains

  • Solution: Validate antibody specificity extensively; include appropriate negative controls; consider epitope-tagged versions for specific detection

How should conflicting data about lnt2 function be reconciled in research publications?

When encountering conflicting data about Leptospira interrogans lnt2 function, researchers should apply systematic approaches to reconcile discrepancies:

1. Methodological Comparison:

  • Critically evaluate differences in experimental methods, including:

    • Protein expression and purification protocols

    • Assay conditions (pH, temperature, buffer composition)

    • Detection methods and their sensitivity limits

    • Substrate preparation and presentation

2. Strain and Sequence Variation Analysis:

  • Determine if conflicting results stem from genetic differences between Leptospira strains

  • Compare protein sequences used in different studies

  • Consider how virulent vs. attenuated strains might display different enzyme properties

3. Contextual Factors Evaluation:

  • Assess environmental conditions that may influence enzyme behavior

  • Consider host-specific factors that could modify activity in vivo

  • Examine temporal aspects of enzyme expression and activity

4. Integrated Data Analysis Framework:

  • Develop a unified model that accommodates apparently conflicting observations

  • Propose testable hypotheses to resolve discrepancies

  • Design decisive experiments that can distinguish between competing models

5. Collaborative Verification:

  • Establish multi-laboratory validation studies using standardized protocols

  • Share reagents and materials to eliminate source variation

  • Implement blinded testing to minimize bias

When publishing research on lnt2, address conflicts transparently by discussing methodological differences, proposing mechanistic explanations for discrepancies, and acknowledging limitations of current understanding. This approach fosters scientific progress through critical evaluation rather than dismissing contradictory findings.

What are promising strategies for developing inhibitors targeting lnt2 for antimicrobial applications?

Developing inhibitors targeting Leptospira interrogans lnt2 represents a promising antimicrobial strategy, given its essential role in bacterial lipoprotein processing. Several approaches warrant investigation:

1. Structure-Based Drug Design:

  • Utilize crystal structures of lnt2 and related enzymes to identify binding pockets

  • Focus on the catalytic site containing the thioester acyl-intermediate

  • Design transition-state analogs that mimic the reaction intermediate

  • Employ computational docking and molecular dynamics simulations to optimize inhibitor interactions

2. High-Throughput Screening Approaches:

  • Develop miniaturized assays suitable for screening compound libraries

  • Screen diverse chemical libraries including natural product extracts

  • Validate hits with secondary assays measuring direct binding and cellular activity

3. Mechanism-Based Inhibitor Development:

  • Target the distinctive conformational changes observed during catalysis

  • Design covalent inhibitors that react with the catalytic cysteine

  • Explore allosteric inhibitors that prevent essential conformational changes

  • Investigate competitive inhibitors that mimic substrate binding

4. Peptide-Based Inhibitors:

  • Design peptide mimetics based on known apolipoprotein substrates

  • Incorporate non-hydrolyzable linkages to prevent processing

  • Optimize for membrane penetration and target site accessibility

5. Combination Strategies:

  • Target multiple steps in the lipoprotein processing pathway simultaneously

  • Develop dual-action molecules affecting both lnt2 and other essential enzymes

  • Explore synergistic effects with conventional antibiotics

The advantage of targeting lnt2 lies in its absence in mammalian cells, potentially leading to selective toxicity against leptospires with minimal host effects.

How might gene editing techniques be applied to study lnt2 function in Leptospira interrogans?

Gene editing techniques offer powerful approaches to elucidate lnt2 function in Leptospira interrogans through precise genetic manipulation:

1. CRISPR-Cas9 System Adaptation:

  • Optimize CRISPR-Cas9 delivery methods for Leptospira

  • Design specific gRNAs targeting lnt2 gene

  • Create knockdown strains with reduced lnt2 expression

  • Generate conditional mutants using inducible systems

2. Site-Directed Mutagenesis Approaches:

  • Introduce point mutations in catalytic residues

  • Create truncation variants to assess domain functions

  • Generate chimeric proteins with domains from other acyltransferases

  • Develop reporter fusions to monitor expression and localization

3. Complementation Studies:

  • Express wild-type or mutant lnt2 in attenuated strains

  • Assess restoration of virulence phenotypes

  • Evaluate cross-species complementation with lnt2 from other bacteria

4. Genome-Wide Interaction Mapping:

  • Conduct synthetic lethality screens to identify genetic interactions

  • Implement transposon mutagenesis to find suppressors or enhancers of lnt2 phenotypes

  • Develop comprehensive genetic interaction maps

5. In Vivo Function Analysis:

  • Create fluorescently tagged lnt2 variants to track subcellular localization

  • Implement proximity labeling to identify interaction partners

  • Develop biosensors to monitor lnt2 activity in living cells

These approaches must account for the essential nature of lnt2, potentially requiring conditional systems or partial loss-of-function mutations to maintain viability while studying function.

What role might lnt2 play in vaccine development against leptospirosis?

Leptospira interrogans lnt2 presents several opportunities for leptospirosis vaccine development, leveraging its critical role in lipoprotein processing:

1. Direct Antigen Application:

  • Evaluate recombinant lnt2 as a vaccine antigen

  • Assess immunogenicity and protective efficacy in animal models

  • Target conserved epitopes present across Leptospira serovars

  • Design rationally attenuated lnt2 variants that maintain immunogenicity

2. Lipoprotein Processing Manipulation:

  • Create attenuated Leptospira strains with modified lnt2 function

  • Engineer strains producing altered lipoprotein profiles as live attenuated vaccines

  • Design subunit vaccines containing optimally modified lipoproteins

3. Adjuvant Technology:

  • Exploit lnt2-processed lipoproteins as natural adjuvants

  • Develop synthetic lipoprotein adjuvants mimicking lnt2 products

  • Create conjugate vaccines linking lnt2-processed lipid moieties to protective antigens

4. Cross-Protection Strategies:

  • Identify conserved lnt2 epitopes across different Leptospira serovars

  • Develop multivalent vaccines targeting common lipoprotein processing pathways

  • Assess cross-protective immune responses against diverse Leptospira strains

5. Mechanism-Based Vaccination Approaches:

  • Target essential steps in lnt2-mediated lipoprotein processing

  • Develop vaccines that induce antibodies blocking lnt2 function

  • Design immunization strategies that disrupt bacterial membrane integrity

Recent research on leptospiral proteins suggests that surface proteins like LIC11051 and LIC11505 are recognized by antibodies in leptospirosis serum samples, indicating their expression during infection and potential immunogenicity . Similar approaches could be applied to assess lnt2's potential as a vaccine candidate.

What are the most significant recent advances in understanding lnt2 function in Leptospira?

Recent advances in understanding Leptospira interrogans lnt2 function have expanded our knowledge in several key areas:

1. Structural Characterization:

  • Crystal structures of related Lnt enzymes have revealed multiple conformational states, including the thioester acyl-intermediate and potential apolipoprotein docking conformations

  • Identification of essential residues involved in substrate recognition and catalysis

  • Recognition of the importance of conformational changes, particularly involving conserved tryptophan residues, in coordinating the catalytic cycle

2. Expression and Localization:

  • Successful expression and purification of full-length recombinant lnt2 (595 amino acids) with maintained structural integrity

  • Improved understanding of membrane association and topology

  • Insights into protein stability requirements and optimal buffer conditions

3. Functional Integration:

  • Growing appreciation of lnt2's role within the broader context of Leptospira pathogenesis

  • Connections to other virulence mechanisms, including those mediated by surface proteins like LIC11051 and LIC11505

  • Recognition of the essential nature of lipoprotein processing for bacterial survival and host interaction

4. Technological Developments:

  • Improved recombinant expression systems for membrane-associated leptospiral proteins

  • Advanced purification methods maintaining native-like conditions

  • Development of functional assays to monitor enzymatic activity

These advances collectively provide a foundation for future studies aimed at therapeutic intervention and vaccine development targeting this essential bacterial enzyme.

How does research on lnt2 contribute to our broader understanding of Leptospira pathogenesis?

Research on Leptospira interrogans lnt2 contributes significantly to our understanding of leptospiral pathogenesis through multiple interconnected mechanisms:

1. Lipoprotein Maturation Pathway:

  • Lnt2 represents a critical component in the three-step lipoprotein processing pathway unique to Gram-negative bacteria

  • Mature lipoproteins facilitated by lnt2 activity serve diverse functions in pathogenesis, including adhesion, immune evasion, and nutrient acquisition

  • The enzyme's activity directly impacts the composition and function of the bacterial cell envelope

2. Virulence Factor Expression:

  • Properly processed lipoproteins function as key virulence factors during infection

  • Studies on other Leptospira proteins like LIC11051 and LIC11505 demonstrate their importance in host interaction, with potential similar roles for lnt2-processed proteins

  • The N-acylation step performed by lnt2 affects lipoprotein targeting and localization within the bacterial cell envelope

3. Host-Pathogen Interface:

  • Lipoproteins processed by lnt2 interact directly with host components

  • These interactions influence adhesion to host tissues, immune recognition, and inflammatory responses

  • Research suggests some leptospiral surface proteins can bind GAGs and integrin receptors, functions potentially dependent on proper lnt2-mediated processing

4. Environmental Adaptation:

  • Lipoprotein processing by lnt2 may enable adaptation to diverse environmental conditions

  • Differential expression patterns between virulent and culture-attenuated strains suggest connections to pathogenicity

  • Lnt2 activity may vary between pathogenic and saprophytic Leptospira species, reflecting their distinct ecological niches

This research highlights the interconnected nature of bacterial protein processing and virulence, establishing lnt2 as a key component in the complex pathogenesis of leptospirosis, a disease increasingly recognized as an emerging and re-emerging threat due to global climate changes .

What specialized equipment and resources are most valuable for lnt2 research?

Conducting comprehensive research on Leptospira interrogans lnt2 requires specialized equipment and resources across multiple technical domains:

1. Protein Expression and Purification:

  • Bioreactors: For controlled large-scale expression

  • FPLC systems: For multi-step purification protocols

  • Specialized centrifuges: For membrane fraction isolation

  • Anaerobic chambers: For oxygen-sensitive protein handling

2. Structural Analysis:

  • X-ray crystallography setup: For high-resolution structure determination

  • Cryo-electron microscopy: For analyzing protein in near-native states

  • Circular dichroism spectropolarimeter: For secondary structure analysis

  • Differential scanning calorimetry: For thermal stability assessment

3. Functional Characterization:

  • Stopped-flow apparatus: For rapid kinetic measurements

  • Surface plasmon resonance: For binding affinity determination

  • HPLC-MS systems: For product analysis

  • Isothermal titration calorimetry: For thermodynamic characterization

4. Cellular and Molecular Biology:

  • BSL-2 facilities: For working with Leptospira cultures

  • Fluorescence microscopy: For localization studies

  • qPCR equipment: For expression analysis

  • Gene editing tools: For creating mutant strains

5. Computational Resources:

  • Molecular dynamics simulation software: For modeling conformational changes

  • Molecular docking programs: For substrate binding prediction

  • Bioinformatics pipelines: For comparative genomic analysis

  • High-performance computing access: For resource-intensive calculations

6. Specialized Reagents:

  • Detergent libraries: For optimizing membrane protein stability

  • Synthetic lipid collections: For reconstitution experiments

  • Custom antibodies: For specific detection of lnt2 and products

  • Synthetic substrate analogs: For mechanistic studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.