Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobD; LIC_20120; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
cobD
Target Protein Sequence
MPWGIAISILVDLILGDPKDLPHPVRAIGKLARALEKFFRNNCSSEEIAGILTSCLVYLI SFIIPFLSVQFANQLHWILGELLSIMIIYTTIAIRDMIDHSKEVYDALVQTNLPLARKKV SKIVARDTENLSESEIIRACVESTAENLVDGITTPLFYAVFGGPAWAMLYRSINTLDSLF GYKNKKYLRFGSFPARIDDLANYLPARITSYILVLSSLFLGYNFKNSLYILQRDGKKHPS PNSGLTEAAVAGALEIQLGGVNLYSGVQNIKPKLGDPKKEFQIEQILQTNKLILLSSILT FIFYILIYSGAAYFL
Uniprot No.

Target Background

Function
CobD catalyzes the conversion of cobyric acid to cobinamide by adding aminopropanol to the F carboxylic group.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CobD in the cobalamin biosynthesis pathway?

CobD functions as an L-threonine-O-3-phosphate decarboxylase that generates (R)-1-amino-2-propanol O-2-phosphate. This enzymatic activity is critical for the synthesis of the aminopropanol phosphate component that is subsequently attached to the f side chain of adenosylcobyric acid during cobalamin biosynthesis . In Salmonella enterica serovar Typhimurium, studies have demonstrated that cobD mutants can be restored by adding exogenous (R)-aminopropanol, suggesting that a kinase phosphorylates this molecule before its incorporation into cobyric acid .

Methodological approach for studying CobD function:

  • Gene knockout experiments targeting cobD

  • Complementation assays with exogenous substrates

  • In vitro enzymatic assays measuring decarboxylase activity

  • Structural analysis of substrate binding and catalysis

How is CobD structurally characterized and how does this relate to its function?

The structure of Salmonella Typhimurium CobD has been resolved, revealing that the native protein exists as a dimer where each subunit consists of a large and a small domain . Structural studies show that CobD is similar to members of the aspartate aminotransferase family, with its active site most closely resembling that observed in histidinol phosphate aminotransferase . This structural similarity suggests a potential evolutionary relationship between these enzymes.

Multiple structural states of CobD have been characterized, including:

  • The apo state

  • The apo state complexed with substrate

  • The external aldimine complex

These structural studies have provided insights into how the enzyme directs the breakdown of the external aldimine toward decarboxylation rather than amino transfer . Understanding these mechanisms is essential for characterizing the catalytic activity of recombinant Leptospira interrogans CobD.

How does CobD from Leptospira interrogans compare to homologous proteins in other bacterial species?

While the search results don't provide specific information about Leptospira interrogans CobD, we can infer its characteristics by comparing it with well-studied CobD proteins. The CobD function appears to be conserved across diverse bacterial species, but with potential variations in:

  • Substrate specificity and catalytic efficiency

  • Structural features affecting oligomerization

  • Regulatory mechanisms controlling expression

  • Integration with other cobalamin biosynthesis enzymes

To properly characterize Leptospira interrogans CobD, researchers should:

  • Perform sequence alignments with known CobD proteins

  • Construct phylogenetic trees to determine evolutionary relationships

  • Conduct heterologous expression and functional assays

  • Compare enzymatic parameters (KM, kcat) across species

What experimental design approaches are most appropriate for studying recombinant CobD enzymatic activity?

Based on modern experimental design principles, several approaches can be optimized for studying CobD:

  • For initial screening of factors affecting CobD activity:

    • Fractional factorial designs are recommended when investigating multiple variables (pH, temperature, substrate concentration, cofactors) . This approach allows researchers to identify the most significant factors with fewer experiments than a full factorial design.

  • For detailed characterization of critical parameters:

    • Full factorial designs provide complete information about main effects and interaction terms when examining a smaller number of critical factors identified in the screening phase .

  • For optimization of reaction conditions:

    • Central Composite Designs (CCDs) include additional test points at the center and faces of the design space, enabling the fitting of more complex models with non-linear dependencies . This is particularly useful for optimizing conditions for maximum enzymatic activity.

Design TypeAdvantagesBest Use CaseNumber of Experiments (3 factors)
Fractional FactorialEfficient screening with fewer runsInitial factor screening4-8
Full FactorialComplete information on interactionsDetailed characterization8 (2-level)
Central CompositeCan model curved responsesOptimization, non-linear effects15-20

How does CobD integrate into the divergent aerobic and anaerobic cobalamin biosynthesis pathways?

Cobalamin biosynthesis can proceed through either aerobic or anaerobic pathways, which diverge after the synthesis of precorrin-2 and rejoin around the biosynthesis of adenosylcobyrinic acid a,c-diamide . CobD functions in both pathways but with pathway-specific interactions:

In the aerobic pathway (exemplified by Pseudomonas denitrificans):

  • CobD operates alongside CobC and protein α

  • The pathway inserts cobalt at a late stage

  • Molecular oxygen is required for ring contraction

In the anaerobic pathway (exemplified by Salmonella Typhimurium):

  • CobD works with CbiP

  • Cobalt is inserted at an early stage

  • Ring contraction occurs without oxygen dependency

This table compares the aerobic and anaerobic pathways with focus on CobD function:

Understanding the integration of Leptospira interrogans CobD in these pathways would require:

  • Expression of recombinant protein in both aerobic and anaerobic conditions

  • Interaction studies with pathway-specific partner proteins

  • Functional assays under varying oxygen concentrations

  • Complementation studies in model organisms with defined pathway variants

What are the most effective methods for expressing and purifying recombinant Leptospira interrogans CobD for structural studies?

For successful expression and purification of recombinant Leptospira interrogans CobD, researchers should consider:

  • Expression system selection:

    • E. coli BL21(DE3) with pET vectors for high-level expression

    • Cold-adapted strains for improved protein folding at lower temperatures

    • Fusion tags (His, GST, MBP) to enhance solubility and facilitate purification

    • Codon optimization to address potential rare codon issues

  • Expression optimization:

    • Testing multiple induction conditions (temperature, inducer concentration, time)

    • Screening various media formulations

    • Co-expression with molecular chaperones

    • Testing periplasmic vs. cytoplasmic expression

  • Purification strategy:

    • Multi-step chromatography (affinity, ion exchange, size exclusion)

    • On-column refolding for inclusion body recovery

    • Buffer optimization to maintain dimeric state

    • Quality control by analytical size exclusion and activity assays

  • Structural study preparation:

    • Concentration optimization to avoid aggregation

    • Buffer screening for crystallization

    • Limited proteolysis to identify stable domains

    • Dynamic light scattering to assess homogeneity

For crystallization studies specifically, researchers should consider implementing a CCD experimental design to optimize crystallization conditions, as this allows for systematic exploration of precipitant concentration, pH, temperature, and additives with fewer experimental trials .

How can site-directed mutagenesis be used to investigate the catalytic mechanism of CobD?

Based on the structural information about CobD's relationship to aspartate aminotransferases and its unique ability to direct reactions toward decarboxylation rather than amino transfer , a systematic mutagenesis approach could include:

  • Target selection:

    • Residues in the active site that interact with the phosphate group

    • Amino acids involved in forming the external aldimine complex

    • Residues potentially involved in proton transfer

    • Amino acids at the dimer interface

  • Mutagenesis strategy:

    • Alanine scanning of conserved residues

    • Conservative substitutions to probe specific interactions

    • Introduction of residues found in related enzymes with different specificities

    • Creation of chimeric proteins with other aminotransferase domains

  • Functional analysis:

    • Steady-state kinetics to determine KM and kcat changes

    • Pre-steady-state kinetics to identify rate-limiting steps

    • pH-rate profiles to identify catalytic residues

    • Substrate analog studies to probe binding determinants

  • Structural validation:

    • X-ray crystallography of key mutants

    • Hydrogen-deuterium exchange mass spectrometry

    • Molecular dynamics simulations to predict and interpret mutational effects

This systematic approach would provide comprehensive insights into which residues are essential for substrate binding, catalysis, and maintaining the correct enzyme conformation in Leptospira interrogans CobD.

What are the optimal analytical methods for assessing CobD enzymatic activity in vitro?

Several complementary approaches can be employed to measure CobD's L-threonine-O-3-phosphate decarboxylase activity:

  • Direct product detection methods:

    • HPLC separation coupled with UV or fluorescence detection

    • LC-MS/MS for precise identification and quantification

    • NMR spectroscopy for structural confirmation of reaction products

  • Coupled enzyme assays:

    • Linking CobD activity to enzymes producing spectrophotometric signals

    • Continuous monitoring of reaction progress

    • Higher throughput for inhibitor screening

  • Decarboxylation detection methods:

    • Radiometric assays with 14C-labeled substrate

    • pH indicators to detect pH changes from CO2 release

    • CO2 gas-sensing systems

  • Optimization considerations:

    • Buffer composition (phosphate vs. HEPES vs. Tris)

    • Metal ion requirements (Mg2+, Mn2+)

    • Temperature and pH optimization

    • Substrate concentration ranges for kinetic determinations

Method selection should be guided by experimental objectives:

Analytical MethodSensitivityThroughputBest Application
HPLC-MS/MSVery HighLow-MediumDefinitive product identification
Spectrophotometric Coupled AssayMediumHighKinetic studies, inhibitor screening
Radiometric AssayHighMediumLow activity detection
NMRMediumLowReaction mechanism studies

How can researchers design experiments to investigate CobD's interaction with other proteins in the cobalamin biosynthetic pathway?

Investigating protein-protein interactions involving CobD requires a multi-faceted approach:

  • Initial screening methods:

    • Yeast two-hybrid or bacterial two-hybrid systems

    • Co-immunoprecipitation with tagged proteins

    • Protein microarrays with recombinant pathway components

  • Interaction validation and characterization:

    • Surface Plasmon Resonance (SPR) for binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamics

    • Size exclusion chromatography to detect complex formation

    • Analytical ultracentrifugation for stoichiometry determination

  • Structural characterization of complexes:

    • X-ray crystallography of co-crystallized proteins

    • Cryo-electron microscopy for larger complexes

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Hydrogen-deuterium exchange to map binding surfaces

  • Functional validation:

    • Enzymatic assays with reconstituted protein complexes

    • Mutagenesis of predicted interaction interfaces

    • In vivo complementation with interaction-deficient mutants

Applying DoE principles to these investigations can significantly improve efficiency:

  • Use fractional factorial designs for initial screening of multiple potential interactions

  • Apply full factorial designs to thoroughly characterize confirmed interactions

  • Implement CCDs to optimize conditions for complex formation and crystallization

What bioinformatic approaches can predict functional properties of CobD variants across bacterial species?

To characterize and predict functional properties of CobD across different bacterial species, including Leptospira interrogans:

  • Sequence-based analyses:

    • Multiple sequence alignment to identify conserved motifs

    • Phylogenetic analysis to understand evolutionary relationships

    • Conservation analysis to identify functionally important residues

    • Coevolution analysis to detect pairs of residues that evolve together

  • Structure-based predictions:

    • Homology modeling based on known CobD structures

    • Molecular docking to predict substrate binding modes

    • Molecular dynamics simulations to explore conformational dynamics

    • Electrostatic surface analysis to identify potential interaction interfaces

  • Genomic context analysis:

    • Gene neighborhood examination across species

    • Identification of gene fusion events

    • Coexpression pattern analysis

    • Detection of horizontal gene transfer events

  • Integration with experimental data:

    • Machine learning models combining sequence/structure features with activity data

    • Network analysis of protein-protein interactions

    • Pathway reconstruction across species

    • Correlation of sequence variations with enzymatic parameters

These approaches can help predict how CobD variants might differ in:

  • Substrate specificity

  • Catalytic efficiency

  • Protein-protein interaction networks

  • Environmental adaptations (temperature, pH optima)

How can researchers design experiments to determine if CobD could be a potential antimicrobial target?

Given the importance of cobalamin in bacterial metabolism, CobD could represent a potential antimicrobial target, particularly for organisms like Leptospira interrogans that rely on de novo cobalamin synthesis. A systematic experimental approach would include:

  • Target validation studies:

    • Construction of defined cobD deletion mutants

    • Growth and survival analysis under various conditions

    • Complementation with wild-type cobD to confirm phenotype specificity

    • Competitive growth assays against wild-type strains

  • Inhibitor discovery approaches:

    • Structure-based virtual screening against CobD active site

    • Fragment-based screening using thermal shift assays

    • High-throughput enzymatic assays with compound libraries

    • Phenotypic screening followed by target identification

  • Inhibitor characterization:

    • Enzyme kinetics to determine inhibition mechanisms

    • X-ray crystallography of enzyme-inhibitor complexes

    • Cellular uptake and metabolism studies

    • Selectivity profiling against human enzymes

  • Antimicrobial efficacy assessment:

    • Minimum inhibitory concentration (MIC) determination

    • Time-kill studies to assess bactericidal vs. bacteriostatic effects

    • Resistance development monitoring

    • Efficacy in infection models

Experimental design considerations should include:

  • Fractional factorial designs for initial inhibitor screening

  • Full factorial designs for detailed characterization of promising compounds

  • CCDs for optimization of inhibitor properties and formulations

  • Appropriate controls including existing antibiotics and non-pathogenic model organisms

By applying these methodological approaches, researchers can comprehensively investigate whether Leptospira interrogans CobD represents a viable antimicrobial target and develop strategies for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.