Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to cobS

Cobalamin synthase (cobS) is a critical enzyme in the cobalamin (vitamin B12) biosynthesis pathway of Leptospira interrogans serovar Copenhageni. This enzyme catalyzes the final steps of cobalamin production, essential for bacterial metabolic processes, including methionine synthesis and carbon rearrangement . The recombinant form of cobS is engineered to facilitate functional studies, structural analysis, and potential vaccine development against leptospirosis .

Molecular Characterization

The cobS gene (LIC_13357) in L. interrogans serovar Copenhageni is located on chromosome I. Key features include:

  • UniProt ID: Q72M34

  • Protein Length: 265 amino acids (recombinant construct spans residues 1–265)

  • Domain: Contains a conserved cobalamin synthase domain critical for adenosylcobalamin biosynthesis .

Sequence Analysis:
The recombinant cobS retains the catalytic residues necessary for binding to precorrin-6A and transferring the adenosyl group . Structural modeling suggests homology to cobalamin synthases in Salmonella enterica (35% identity) .

Genomic Context and Biosynthetic Pathway

CobS operates within a multi-enzyme cobalamin biosynthesis pathway distributed across both chromosomes of L. interrogans :

GeneChromosomeFunction
cobSIFinal adenosylation of cobalamin
cobC, cobDIIEarly corrin ring modification
cysG/hemXITetrapyrrole synthesis

This pathway enables de novo cobalamin synthesis, a trait absent in other spirochetes like Borrelia burgdorferi .

Functional Insights

  • Enzymatic Activity: Recombinant cobS catalyzes the adenosylation of cobalamin precursors, confirmed via in vitro assays using E. coli-expressed protein .

  • Iron Regulation: CobS expression is upregulated under iron-limited conditions, as shown by proteomic studies (1.3-fold increase in low-iron media) .

  • Pathogenic Role: Cobalamin biosynthesis is critical for L. interrogans survival in host environments, particularly during renal colonization .

Recombinant cobS Production

Expression and Purification:

  • Host System: Escherichia coli with a His-tag fusion .

  • Yield: ~1.6 mg/L culture under optimized conditions .

  • Storage: Tris-based buffer with 50% glycerol at -80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping method uses standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
cobS; LIC_13357; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
cobS
Target Protein Sequence
MNKLQEEWNRFCASWMFNTRLPILPFYVYSESTLSRSSRYFPLIGWIVSAGTSYSTYFLS WILPIEISIILGMILSVLITGGFHEDGLADVCDAFGGGWSKEKILEIMKDSRIGTFGSIG LILSLGLKYLLLVNLFKISPWIFLFTSWFSHSASRWFALLLMMLIPYARENDLSKSKPMI KKLPPFDFALSTFFGCFPAVYFLYQFQNQIPNVLLGFFLSSIFVFYFRNYFNKWIEGFTG DCLGFIQQGTELLFYLGITVSWNSI
Uniprot No.

Target Background

Function

This enzyme catalyzes the formation of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the significance of L. interrogans serogroup Icterohaemorrhagiae serovar copenhageni in disease research?

L. interrogans serogroup Icterohaemorrhagiae is considered among the most virulent Leptospira strains, responsible for the majority of severe human leptospirosis cases worldwide. Serovar Copenhageni, a major representative of this serogroup, has significant epidemiological importance due to its global distribution and association with severe clinical outcomes. The bacteria causes zoonotic infection that is considered an emerging and re-emerging threat, particularly following heavy rainfall and flooding when outbreaks frequently occur . Understanding this organism is crucial for developing intervention strategies against leptospirosis.

Researchers typically identify and classify L. interrogans serovar Copenhageni using microscopic agglutination testing (MAT) with both polyclonal sera for serogroup confirmation and monoclonal sera for distinguishing between closely related serovars like Icterohaemorrhagiae and Copenhageni . Genomic sequencing has further refined classification methods, revealing unique genetic markers that differentiate between serovars despite their close phylogenetic relationship. Notably, comparative gene expression analysis has shown that virulent strains may exhibit up to 28-fold higher expression of certain genes compared to culture-attenuated strains , highlighting the complexity of virulence mechanisms in this pathogen.

How do Leptospira serovars Copenhageni and Icterohaemorrhagiae differ genetically?

Despite being closely related members of the same serogroup, L. interrogans serovars Copenhageni and Icterohaemorrhagiae display distinct genetic differences that have been characterized through comprehensive genomic analyses. Whole genome sequencing studies of 67 isolates (55 Copenhageni and 12 Icterohaemorrhagiae) identified 1,072 single nucleotide polymorphisms (SNPs), with 796 located in coding regions and 276 in non-coding regions . Additionally, 258 insertion/deletion (indel) mutations were characterized, with 191 found in coding regions.

The most significant discriminatory genetic marker identified between these serovars is a frameshift mutation within a homopolymeric tract of the lic12008 gene, which is involved in lipopolysaccharide (LPS) biosynthesis . This mutation is present in all examined Icterohaemorrhagiae strains but absent in Copenhageni strains, making it a reliable genetic marker for differentiation. This is particularly relevant since LPS structure determines serovar identity in Leptospira species. Phylogenetic analyses based on SNP datasets confirm that while both serovars are closely related, they exhibit distinct spatial clustering, suggesting geographical separation in their evolution .

What is cobalamin synthase (cobS) and what role does it play in bacterial metabolism?

Cobalamin synthase (cobS) is a key enzyme in the cobalamin (vitamin B12) biosynthetic pathway in bacteria. This enzyme catalyzes one of the final steps in the complex B12 synthesis process, specifically the attachment of the upper axial ligand during corrin ring assembly. In L. interrogans and other pathogenic bacteria, the ability to synthesize cobalamin de novo represents a significant metabolic advantage during infection.

Genomically-predicted metabolic reconstructions have identified complete cobalamin biosynthesis pathways predominantly in pathogenic Leptospira species, with evidence suggesting this capability serves as a bacterial virulence factor . This metabolic capability is particularly important because cobalamin functions as an essential cofactor for numerous enzymes involved in:

  • Methionine synthesis

  • DNA synthesis (via ribonucleotide reductase)

  • Methylmalonyl-CoA mutase activity (important for propionate metabolism)

  • Various methylation reactions critical for cellular function

The presence of complete cobS and related genes in pathogenic but not saprophytic Leptospira suggests evolution has selected for maintenance of this metabolic pathway specifically in strains that infect mammals . This adaptation likely provides a competitive advantage in the nutrient-limited environment of host tissues, where external sources of cobalamin may be restricted as part of nutritional immunity.

What approaches can be used to express and purify recombinant L. interrogans cobS?

Expression and purification of recombinant L. interrogans cobS requires careful optimization of multiple parameters to achieve functional protein. Based on successful protocols for other Leptospira proteins, the following methodological approach is recommended:

For expression vector selection, the pAE expression vector system has proven effective for Leptospira protein expression, adding a C-terminal 6xHis tag that facilitates purification . This vector includes an inducible T7 promoter for controlled expression. E. coli BL21(DE3) or Rosetta strains are preferred host cells, with the latter being advantageous if the cobS gene contains rare codons found in Leptospira but uncommon in E. coli.

Expression conditions should be systematically optimized by testing various parameters:

ParameterRecommended RangeRationale
Temperature16-25°CLower temperatures often improve solubility
IPTG concentration0.1-1.0 mMOptimal induction strength varies by protein
Induction duration4-16 hoursBalance between yield and aggregation
Media compositionLB, TB, or minimal mediaDepends on downstream applications

If initial expression attempts yield insoluble protein in inclusion bodies (as observed with some Leptospira proteins ), solubility enhancement strategies should be considered, including fusion to solubility tags (MBP, GST, or SUMO), co-expression with chaperones, or optimization of refolding protocols. For purification, immobilized metal affinity chromatography (IMAC) exploiting the His-tag should be followed by additional purification steps such as ion exchange or size exclusion chromatography to achieve high purity.

Critical to successful expression is verification of proper folding and function through enzyme activity assays specific to cobS. This systematic approach maximizes the likelihood of obtaining functional recombinant protein for further studies.

How can researchers verify the functional activity of recombinant cobS enzyme in vitro?

Verifying the functional activity of recombinant cobS enzyme requires specific assays targeting its catalytic role in the cobalamin biosynthetic pathway. A comprehensive approach includes multiple complementary methods:

Spectrophotometric assays can monitor the conversion of substrates to products based on their different absorption profiles. For cobS, this involves following the ATP-dependent attachment of the upper axial ligand to the corrin ring intermediate. Changes in the characteristic absorption spectrum of corrinoids can be measured at specific wavelengths (typically between 350-550 nm) to track reaction progress.

High-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC-MS) analysis provides more definitive evidence of enzymatic activity. These techniques separate and quantify reaction substrates, intermediates, and products based on their distinct chemical properties. For cobS activity assessment, the following protocol is recommended:

  • Incubate purified recombinant cobS with hydrogenobyrinic acid a,c-diamide substrate, ATP, GTP, and appropriate metal cofactors

  • Extract reaction products at various timepoints

  • Analyze by HPLC-MS to detect the formation of cobyric acid and quantify conversion rates

  • Calculate kinetic parameters (Km, Vmax, kcat) under optimized conditions

Complementation assays in E. coli strains with cobS gene deletions offer a functional verification approach. Expression of active L. interrogans cobS should restore growth under conditions requiring cobalamin-dependent metabolism. Combined with the biochemical assays above, this provides strong evidence for proper enzyme function and can reveal unique properties of the Leptospira enzyme compared to other bacterial cobS proteins.

What challenges are associated with creating cobS knockout mutants in L. interrogans?

Creating gene knockout mutants in pathogenic Leptospira species presents significant technical challenges that must be addressed with specialized approaches. Several factors contribute to the difficulty in generating cobS mutants specifically:

The presence of CRISPR/Cas systems uniquely found in pathogenic Leptospira species likely contributes to their recalcitrance to genetic manipulation . These defense systems may recognize and degrade foreign DNA introduced during transformation attempts. Researchers must design transformation strategies that avoid CRISPR recognition, potentially by using native Leptospira DNA sequences for homologous recombination regions or by temporarily inactivating the CRISPR/Cas system.

Pathogenic Leptospira exhibit extremely low transformation efficiencies compared to saprophytic species, necessitating optimization of electroporation conditions specifically for L. interrogans. This includes careful adjustment of field strength, buffer composition, DNA concentration, and cell preparation protocols. Additionally, if cobS functions as an essential gene, direct knockout attempts will fail. This necessitates conditional knockout strategies such as inducible promoters or protein degradation systems.

The limited selection markers validated for use in Leptospira further complicates mutant creation. Researchers should consider developing new selection systems or implementing marker-free approaches like Cre-lox recombination. Finally, potential mutants require careful phenotypic verification, which is complicated by the slow growth of Leptospira and possible requirements for cobalamin supplementation to maintain viability of cobS mutants.

Given these challenges, research groups should consider parallel approaches, including transposon mutagenesis screening combined with targeted deletion attempts using optimized constructs. Each potential mutant requires thorough verification through PCR, sequencing, and phenotypic analysis to confirm the specific disruption of cobS without affecting surrounding genes.

How does cobalamin biosynthesis contribute to L. interrogans virulence?

Cobalamin (vitamin B12) biosynthesis has emerged as a significant virulence factor in pathogenic Leptospira species through several mechanisms revealed by comparative genomic and functional studies. Genomically-predicted metabolic reconstructions have demonstrated that complete pathways for cobalamin biosynthesis are predominantly found in pathogenic Leptospira species but absent or incomplete in non-pathogenic strains , suggesting evolutionary selection for this metabolic capability specifically in the context of host infection.

The contribution of cobalamin biosynthesis to virulence likely involves multiple mechanisms:

  • Metabolic independence: The ability to synthesize this essential cofactor autonomously enables growth in host environments where cobalamin availability is restricted, either naturally or through host nutritional immunity mechanisms.

  • Support for virulence-associated processes: Many virulence-associated enzymes require cobalamin as a cofactor. These include processes involved in amino acid metabolism, DNA synthesis, and fatty acid degradation, which are critical during host colonization and dissemination.

  • Interference with host processes: Bacterial cobalamin or its precursors may directly interact with host metabolic or immune processes, potentially redirecting host responses in favor of bacterial survival.

  • Energy efficiency: De novo cobalamin synthesis, while metabolically expensive, may provide long-term energetic advantages by enabling access to alternative carbon and energy sources during infection.

Research has demonstrated that virulent L. interrogans strains show significantly higher expression of various genes compared to attenuated strains , which could include the cobS gene and other components of the cobalamin biosynthetic pathway. This differential expression further supports the connection between cobalamin synthesis and virulence potential in these bacteria.

How can researchers distinguish between the effects of cobS dysfunction and other metabolic perturbations?

Genetic complementation studies represent the gold standard for establishing causality between genotype and phenotype. Wild-type cobS should be reintroduced into cobS-deficient strains using controlled expression systems. If phenotypes are specifically rescued by complementation, this confirms direct attribution to cobS rather than polar effects or secondary mutations. The complementation should be performed with both constitutive and inducible promoters to allow titration of expression levels.

Strategic metabolite supplementation can differentiate between direct and indirect effects. Growth media or infection models can be supplemented with cobalamin to bypass the need for de novo synthesis. If phenotypes are specifically rescued by cobalamin but not by other metabolic supplements, this indicates specificity to this pathway. Testing with pathway intermediates can further pinpoint the specific blocked metabolic step.

For systems-level analysis, integrated multi-omics approaches can comprehensively map the consequences of cobS dysfunction:

ApproachMethodologyInformation Provided
MetabolomicsLC-MS/MS profilingDirect metabolic consequences
TranscriptomicsRNA-seqCompensatory gene expression changes
ProteomicsLC-MS/MSProtein-level adaptations
Fluxomics13C-labeled substrate tracingChanges in metabolic flux distribution

Data from these approaches should be analyzed using multivariate statistical methods like principal component analysis to distinguish specific cobS-associated patterns from general stress responses. Temporal analysis monitoring changes over time after cobS inhibition can further separate primary effects from secondary adaptations, with true direct effects occurring earlier in the response cascade.

What bioinformatic approaches are most effective for analyzing cobS conservation across Leptospira species?

Comprehensive bioinformatic analysis of cobS conservation across Leptospira species requires integration of sequence-based, structural, and genomic context approaches to develop a complete evolutionary profile. The most effective methodological framework includes:

Domain architecture and motif analysis using tools like NCBI Conserved Domain Database, Pfam, or InterPro identifies functional domains and species-specific insertions or deletions that might confer functional differences. This should be complemented by selection pressure analysis calculating dN/dS ratios (non-synonymous to synonymous substitution rates) to determine if cobS is under purifying, neutral, or positive selection across the Leptospira phylogeny.

Genomic context analysis examines the organization of genes surrounding cobS, identifying conserved operons or gene clusters related to cobalamin synthesis. This synteny analysis can reveal whether the entire pathway is conserved or if alternative arrangements exist in different species. Comparative analysis should map the presence, absence, or pseudogenization of cobS across the Leptospira phylogeny and correlate with pathogenicity status (pathogenic vs. intermediate vs. saprophytic).

Advanced structural bioinformatics approaches can generate homology models using tools like SWISS-MODEL or Phyre2 to compare predicted structures across species and identify structurally conserved regions essential for function. This multi-layered analysis provides comprehensive insights into the evolutionary history and functional conservation of cobS, particularly in the context of the demonstrated importance of cobalamin autotrophy as a virulence factor in pathogenic Leptospira .

How does cobS in L. interrogans compare to homologous enzymes in other pathogenic bacteria?

Comparative analysis of cobS between L. interrogans and other pathogenic bacteria reveals both conserved functional elements and species-specific adaptations that may contribute to virulence. While definitive structural data for L. interrogans cobS is limited in current literature, comparative sequence and structure prediction analyses provide valuable insights.

Sequence comparison across diverse bacterial pathogens indicates that cobS proteins typically share conserved catalytic domains necessary for their function in cobalamin biosynthesis. These include:

  • P-loop nucleotide binding domains for ATP hydrolysis

  • Substrate binding domains for cobalamin precursor interaction

  • Metal-binding sites essential for catalytic activity

The degree of sequence conservation varies significantly across bacterial phylogeny, with closest homology observed between spirochetes (like Leptospira and Borrelia), while more distant relationships exist with other pathogens like Mycobacterium tuberculosis or Pseudomonas aeruginosa. These sequence differences likely reflect adaptations to different host environments and metabolic requirements.

Domain organization analysis reveals that while the core catalytic machinery remains conserved, accessory domains and regulatory regions show greater variation. These differences may affect enzyme regulation, interaction with other cellular components, or adaptation to specific cellular environments. Notably, pathogenic bacteria that infect similar host tissues or face similar immune pressures may show convergent adaptations in their cobS proteins despite phylogenetic distance.

The demonstration that cobalamin autotrophy serves as a bacterial virulence factor suggests that comparative analysis of cobS across pathogens could reveal common mechanisms of host adaptation. Future structural biology approaches including X-ray crystallography or cryo-EM of L. interrogans cobS would provide definitive data to complement these computational predictions and potentially reveal unique structural features that could be targeted for therapeutic development.

What evolutionary pressures have shaped cobalamin synthesis in pathogenic Leptospira?

The evolution of cobalamin synthesis in pathogenic Leptospira species reflects complex selective pressures related to their lifecycle, host interactions, and metabolic requirements. Comparative genomic studies between pathogenic, intermediate, and saprophytic Leptospira species have revealed that complete cobalamin biosynthesis pathways appear predominantly in pathogenic lineages , suggesting strong selective pressure to maintain this metabolic capability specifically for pathogenesis.

Host environment adaptation represents a primary evolutionary force. Mammalian hosts typically represent cobalamin-limited environments due to host sequestration mechanisms (nutritional immunity), creating selective pressure for pathogens to develop de novo synthesis capabilities. Different mammalian host species may present varying cobalamin profiles and immune responses, potentially driving adaptation in Leptospira strains with different host preferences.

The question of horizontal gene transfer versus vertical inheritance is particularly relevant. Phylogenetic analysis of cobalamin synthesis genes can reveal whether they show congruent evolutionary history with the core genome or evidence of lateral acquisition. Differences in GC content, codon usage bias, or association with mobile genetic elements would support horizontal transfer scenarios.

Co-evolution with host defenses likely shaped this pathway as well. Host nutritional immunity targets essential bacterial nutrients including metal cofactors required for cobalamin synthesis. This selective pressure may have driven the evolution of high-affinity acquisition systems or alternative metabolic strategies in pathogenic Leptospira.

The association of cobalamin synthesis with pathogenic Leptospira lineages suggests it represents a core component of the virulence toolkit that evolved during adaptation to mammalian hosts, potentially through a combination of horizontal acquisition and subsequent refinement through natural selection.

Can cobS function or expression be correlated with differential virulence among Leptospira strains?

Investigating correlations between cobS function/expression and differential virulence among Leptospira strains requires systematic comparative analysis across multiple strains with varying virulence profiles. Several lines of evidence suggest such a correlation may exist and could be methodically explored.

Expression level correlation studies provide a foundational approach. Research has demonstrated that virulent L. interrogans strains (like L1-130) show significantly higher expression of certain genes compared to attenuated strains (like M20), with some showing up to 28-fold higher relative expression . While cobS specifically was not highlighted in these studies, the pattern suggests virulence-associated genes are differentially regulated in more pathogenic strains. Quantitative RT-PCR or RNA-seq analysis comparing cobS expression across multiple strains with established virulence differences would establish whether such a correlation exists.

Genomic variation assessment represents another analytical avenue. Sequencing cobS and its regulatory regions across multiple strains could identify SNPs, indels, or structural variations that correlate with virulence potential. Analysis of promoter regions might reveal differences in regulatory elements that affect expression levels or responsiveness to environmental cues encountered during infection.

Functional enzyme studies measuring cobS activity and cobalamin production across strains could provide direct evidence linking enzyme function to virulence. LC-MS/MS quantification of cobalamin production in different strains under standardized conditions and during infection models would establish whether higher producers correlate with increased virulence metrics.

The most definitive approach involves genetic modification studies. Engineering strains with controlled cobS expression levels would allow direct testing of how modulation affects virulence in animal models. If increasing cobS expression in attenuated strains enhances virulence, or if reducing expression in virulent strains attenuates pathogenicity, this would establish a causal relationship rather than merely correlation.

Integration of these approaches with careful statistical analysis could determine whether cobS serves as a key virulence determinant or biomarker for predicting the pathogenic potential of Leptospira strains.

How can researchers optimize heterologous expression of L. interrogans cobS in E. coli?

Heterologous expression of L. interrogans cobS in E. coli presents several technical challenges that require systematic optimization strategies. The following methodological framework addresses common issues and solutions:

Codon optimization represents a critical first step. Leptospira species utilize different codon preferences compared to E. coli, which can lead to translational pausing, protein misfolding, or truncation. Two approaches can address this challenge:

  • Synthesize a codon-optimized version of the cobS gene based on E. coli codon usage patterns

  • Express the native sequence in specialized E. coli strains (like Rosetta) that supply rare tRNAs

Expression vector selection significantly impacts protein yield and solubility. While the pAE vector has been successfully used for Leptospira protein expression , alternative vectors should be comparatively evaluated:

Protein solubility can be enhanced through multiple strategies. If initial expression attempts yield inclusion bodies (as observed with some Leptospira proteins ), consider:

  • Lower induction temperature (16-20°C) to slow protein synthesis and improve folding

  • Addition of chemical chaperones to the growth medium (glycerol, sorbitol, arginine)

  • Co-expression with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

  • Fusion to solubility-enhancing tags (MBP, SUMO, TrxA)

For cobS specifically, consideration of metal cofactor requirements is essential. The growth medium should be supplemented with relevant metal ions (typically cobalt, nickel, or zinc) that may be required for proper folding and function. Additionally, expression in a cobalamin synthesis-deficient E. coli strain allows for complementation testing to verify function of the recombinant enzyme simultaneously with expression optimization.

The systematic application of these strategies, with careful Western blot analysis and activity testing of each variant, will identify optimal conditions for producing functional recombinant L. interrogans cobS.

What are the best methods for detecting cobS expression during Leptospira infection?

Detecting cobS expression during Leptospira infection requires sensitive and specific methods capable of distinguishing bacterial gene expression within complex host tissues. A comprehensive approach combines multiple complementary techniques:

Transcriptomic methods provide the most direct measurement of gene expression. RNA-seq analysis of infected tissues can capture the complete transcriptional profile of both host and pathogen genes simultaneously. For specific detection of cobS transcripts:

  • Extract total RNA from infected tissues using methods optimized to preserve bacterial RNA

  • Deplete host rRNA and mRNA (using hybridization-based methods) to enrich for bacterial transcripts

  • Construct libraries and sequence using platforms offering sufficient depth to detect low-abundance bacterial transcripts

  • Apply specialized bioinformatic pipelines to map reads specifically to the L. interrogans genome

For targeted analysis, quantitative RT-PCR offers greater sensitivity for specific gene detection. This requires:

  • Design of primers specific to L. interrogans cobS with no cross-reactivity to host sequences

  • Validation of primer efficiency using standard curves

  • Selection of appropriate reference genes for normalization

  • Analysis using the ΔΔCt method to quantify relative expression

Protein-level detection provides confirmation of translation. This can be achieved through:

  • Immunohistochemistry using anti-cobS antibodies on tissue sections

  • Western blotting of tissue lysates

  • Targeted proteomics approaches like selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

For spatial localization of expression, in situ hybridization targeting cobS mRNA can visualize expression within specific tissue microenvironments. This is particularly valuable for understanding the heterogeneity of expression across different infection sites.

When applying these methods, researchers should include appropriate controls:

  • In vitro cultured bacteria as positive controls

  • Uninfected tissues as negative controls

  • Comparison with housekeeping genes to normalize expression levels

  • Time course analysis to capture dynamic changes in expression

The integration of these approaches provides comprehensive insight into when, where, and how much cobS is expressed during the course of infection, informing our understanding of its role in pathogenesis.

How might structural biology approaches advance our understanding of L. interrogans cobS?

Structural biology approaches offer transformative potential for understanding L. interrogans cobS function and developing targeted interventions. While no crystal structure for this specific enzyme is currently available in the literature, several methodological approaches could yield valuable insights:

X-ray crystallography remains the gold standard for protein structure determination. The approach would involve:

  • Large-scale expression and purification of recombinant L. interrogans cobS with high purity (>95%)

  • Systematic screening of crystallization conditions (pH, salt, precipitants)

  • Crystal optimization to improve resolution

  • Data collection at synchrotron radiation facilities

  • Structure solution by molecular replacement using known bacterial cobS structures as templates

Cryo-electron microscopy (cryo-EM) presents an alternative approach that has revolutionized structural biology. This method:

  • Requires less protein than crystallography

  • Can capture multiple conformational states

  • Does not require crystallization

  • Can resolve structures of membrane-associated forms if relevant to cobS function

Beyond static structures, dynamic analyses provide critical functional insights. Nuclear magnetic resonance (NMR) spectroscopy can examine conformational changes upon substrate binding or during catalysis. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) complements these approaches by mapping regions of structural flexibility and ligand-induced conformational changes.

Computational approaches including molecular dynamics simulations can model enzyme dynamics and predict:

  • Substrate binding mechanisms

  • Conformational changes during catalysis

  • Effects of mutations on stability and function

  • Potential allosteric sites for regulation or inhibition

The structural data would enable structure-based drug design targeting cobS as a potential therapeutic approach. Since cobalamin biosynthesis appears specific to pathogenic Leptospira and serves as a virulence factor , inhibitors of cobS might represent selective anti-virulence agents with minimal effects on the host or commensal microbiota.

What emerging technologies could facilitate cobS research in pathogenic Leptospira?

Several emerging technologies hold transformative potential for advancing cobS research in pathogenic Leptospira, potentially overcoming current technical limitations and opening new investigative avenues:

CRISPR interference (CRISPRi) technology offers a promising alternative to traditional gene knockout approaches, which have proven challenging in pathogenic Leptospira due to their CRISPR/Cas systems . Unlike gene deletion, CRISPRi uses a catalytically inactive Cas9 protein (dCas9) fused to a transcriptional repressor to reduce gene expression without modifying the genome sequence. This approach could enable tunable repression of cobS to study dose-dependent phenotypes without triggering host CRISPR defense mechanisms.

Single-cell technologies provide unprecedented resolution for studying bacterial heterogeneity during infection:

  • Single-cell RNA-seq can identify subpopulations with differential cobS expression

  • Single-cell metabolomics can detect variations in cobalamin production at the individual cell level

  • Spatial transcriptomics can map cobS expression patterns within infected tissues

For in vivo imaging of enzyme activity, genetically encoded biosensors for cobalamin or related metabolites could enable real-time visualization of cobS function during infection. These fluorescent reporters change emission properties upon binding to specific metabolites, allowing non-invasive tracking of cobalamin synthesis in living cells or tissues.

Advanced metabolomics approaches including stable isotope labeling combined with high-resolution mass spectrometry can track cobalamin biosynthesis flux during infection:

  • Feed isotope-labeled precursors (13C, 15N) to infected models

  • Extract metabolites at various timepoints

  • Use LC-MS/MS to trace the incorporation of labeled atoms into cobalamin and intermediates

  • Quantify pathway flux under different conditions

Structural proteomics techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) and cross-linking mass spectrometry (XL-MS) can map protein-protein interactions involving cobS, potentially revealing previously unknown regulatory partners or multienzyme complexes in the cobalamin biosynthetic pathway.

The integration of these emerging technologies with traditional approaches will provide multi-dimensional insights into cobS function and regulation during Leptospira pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.