Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Copenhageni membrane protein insertase YidC (yidC) is a genetically engineered version of the YidC protein produced in heterologous systems such as Escherichia coli. YidC is a conserved bacterial membrane insertase critical for the integration and folding of transmembrane proteins. In pathogenic Leptospira, YidC likely plays a role in virulence by facilitating the insertion of outer membrane proteins involved in host-pathogen interactions, immune evasion, and survival.

Protein Architecture

YidC belongs to the Oxa1/YidC/Alb3 family of membrane insertases. While structural data for Leptospira YidC remains limited, homology modeling based on E. coli YidC (PDB: 6TML) suggests:

  • Five transmembrane domains (TMs) with a cytoplasmic α-helical hairpin between TM2 and TM3 .

  • A hydrophilic groove in the transmembrane region critical for substrate recognition and insertion .

  • Conserved residues (e.g., Arg72 in E. coli) essential for substrate binding and catalytic activity .

Mechanism of Action

YidC operates via a two-step process:

  1. Substrate Binding: The cytoplasmic α-helical hairpin binds nascent membrane proteins co-translationally .

  2. Membrane Insertion: Hydrophobic interactions and electrostatic forces guide the substrate into the lipid bilayer via the hydrophilic groove .

In Leptospira, YidC is hypothesized to mediate the insertion of virulence factors such as LipL32 and other surface-exposed proteins .

Cloning and Expression

  • Expression System: Typically produced in E. coli inclusion bodies due to insolubility in cytoplasmic fractions .

  • Vector: pET or pAE vectors with N-terminal His-tags for affinity purification .

  • Induction: Optimized at 18°C with 1 mM IPTG to minimize aggregation .

Purification and Refolding

StepDetails
Solubilization8 M urea treatment to recover inclusion bodies .
ChromatographyNi-NTA affinity chromatography under denaturing conditions .
RefoldingGradient dialysis to remove urea and restore native conformation .

Quality Assessment

  • Purity: >90% verified by SDS-PAGE .

  • Structural Integrity: Circular dichroism (CD) spectroscopy confirms α-helix and β-sheet content .

Role in Virulence

  • Immune Evasion: Leptospira YidC may assist in inserting proteins like LipL21 and LipL45, which inhibit host myeloperoxidase activity .

  • Host Colonization: Facilitates the integration of adhesins (e.g., LIC13086) that bind extracellular matrix components .

Comparative Genomics

FeatureL. interrogans YidCE. coli YidC
Transmembrane Domains5 (predicted)5 (confirmed)
Substrate SpecificityLipL32, LIC13086Pf3 coat, FoF1 ATPase
Sec-IndependenceLikelyConfirmed

Vaccine Development

  • Chimeric proteins incorporating YidC-inserted antigens (e.g., LipL32) show promise as diagnostic markers or vaccine candidates .

  • Example: A multiepitope chimeric protein (rChi2) achieved 90% sensitivity in detecting leptospirosis antibodies .

Mechanistic Studies

  • Single-molecule force spectroscopy and molecular dynamics simulations reveal YidC’s role in substrate dehydration and membrane integration .

Challenges and Future Directions

  • Heterologous Expression: Low soluble yield necessitates refolding optimization .

  • Functional Validation: In vivo knockout studies are needed to confirm YidC’s role in Leptospira pathogenesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; LIC_10157; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
yidC
Target Protein Sequence
MEDRQTRLFLALILSMGIWMGVNYFFFPNTSTKKNTETKQTQSDKTSENTKQQITSGKTK ESNSADPVVQKEKITPFDTKKSFIVTDSYIVEFSSLGGKISKFYMKDFTGPNGELIQVAR KNPETVVVDGKSYQAVELSRDKGFDFNFSDSLVEISDSPWNYIQFSLTEDKINHSISFSA VSPDRSYQLKKEFRFYPSENYFKLSISIINFSKEKLSFASQKNVRYLRTFGSLGPYPKDR PLSDRDTANFFRFYYLGGSFQDTLDGSSSVGFWSSVGNFFTGNSGTDESFSIKTDKESGV DFAGTGSRYFIAVADPLDHKPHGIVLDNRPKNESGAVLVYDNILLNPGENYNLDFASYIG IRESEGMAFKNPEFDPSQSKNSPFVGLSSDLNKSFNQGITTPFRNGIIWILKQIYRFTIP NYGWSIIIFAILFKLVFYPLNQKQADSMKKMQELSPQLKTINEKFANDPKMRQQKTMELY KKNNVNPVGGCLPMVIQIPIFIALYTAFSDTIDLWNSPFLWVKDLSEPDVIWTSPAIPYF TQTGIGLNLLALLMVGTQVFQTRMTSVSMDPNQKMLMYVMPVMMLYIFWNMPSGVTLYWT FQNVLSIGQQWITNHLKKTEEKKKAKV
Uniprot No.

Target Background

Function
This protein is essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins within the membrane. It plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YidC in Leptospira interrogans membrane protein biogenesis?

YidC in Leptospira interrogans functions as a membrane protein insertase that facilitates the insertion and folding of transmembrane proteins into cellular membranes. YidC is part of a highly conserved family of insertases found across all domains of life, with homologs including Alb3 in chloroplasts and Oxa1 in mitochondria . The insertase plays a crucial role in overcoming the thermodynamic barrier associated with translocating hydrophilic polypeptide residues through the hydrophobic membrane core .

In Leptospira, as in other bacteria, YidC operates through two primary mechanisms:

  • Independent insertion pathway: Directly facilitates insertion of small membrane proteins with limited translocated regions and one or two transmembrane segments

  • YidC-Sec coordinated pathway: Works in conjunction with the Sec translocase for more complex membrane proteins

The insertase contains a conserved 5-transmembrane (TM) core that forms a unique hydrophilic cavity in the inner leaflet facing the cytoplasm but closed from the periplasmic side . This structural arrangement is critical for its function in membrane protein insertion.

How does the hydrophilic groove of YidC contribute to membrane protein insertion in experimental systems?

The hydrophilic groove of YidC plays a pivotal role in membrane protein insertion through a sophisticated mechanism revealed by multiple experimental approaches. The groove contains a conserved positive charge that electrostatically interacts with charges on substrate hydrophilic regions . This interaction recruits substrates into the groove and effectively reduces their membrane-crossing distance .

Experimental evidence supporting this mechanism includes:

  • Crosslinking studies showing MifM substrate binding directly to the groove

  • Molecular dynamics simulations demonstrating membrane thinning around YidC, further reducing the barrier for substrate crossing

  • Single-molecule force spectroscopy and fluorescence spectroscopy revealing a two-step process:

    • Within 2 ms, YidC's cytoplasmic α-helical hairpin binds the substrate polypeptide with high conformational variability

    • Within 52 ms, YidC strengthens binding and transfers the substrate to the membrane-inserted state

These experimental findings suggest a coordinated process where the hydrophilic groove first captures substrate proteins before facilitating their transition to a membrane-inserted state with lower conformational variability typical of transmembrane α-helical proteins .

What single-molecule techniques have proven most effective for studying YidC-mediated insertion dynamics?

Single-molecule approaches have revolutionized our understanding of YidC-mediated membrane protein insertion by revealing dynamic events that are otherwise masked in bulk measurements. The most effective techniques include:

Combined force spectroscopy and fluorescence spectroscopy:
This hybrid approach has proven particularly valuable for tracking the temporal sequence of YidC-substrate interactions. In studies monitoring insertion of the Pf3 substrate, researchers were able to determine precise timing of key events:

  • Initial substrate binding occurs within 2 ms

  • Conformational stabilization and membrane insertion follows within 52 ms

The strength of this combinatorial approach lies in simultaneously tracking both physical forces and conformational changes during the insertion process, providing mechanistic insights impossible with either technique alone.

Molecular dynamics simulations coupled with experimental validation:
Simulations have revealed critical membrane-thinning effects around YidC that facilitate substrate insertion by reducing the hydrophobic barrier . When validated with experimental data from crosslinking or spectroscopy, these computational approaches have proven powerful for testing mechanistic hypotheses.

Site-specific crosslinking studies:
Experimental designs using site-directed crosslinking have mapped the substrate contact sites of YidC, revealing that hydrophobic residues in TM3 and TM5 bind the substrate transmembrane segments . These studies with Pf3 coat protein and MscL have established the "greasy-sliding mechanism" as a key aspect of YidC function .

For researchers beginning work with YidC, these methods should be considered complementary rather than alternatives, as each provides unique insights into different aspects of the insertion process.

How can BioID be optimized for identifying novel YidC interaction partners in Leptospira?

The BioID approach has proven highly effective for identifying YidC interaction partners, as demonstrated by the discovery of YibN as a significant YidC interactor . For researchers seeking to optimize this method specifically for Leptospira interrogans, several methodological considerations are essential:

Optimized BioID protocol for Leptospira YidC studies:

  • Construct design:

    • Fuse the mutant biotin ligase BirA* (BirA R118G) to the C-terminus of YidC

    • Clone into an expression vector suitable for Leptospira (e.g., pBAD22-based vectors have proven effective)

  • Membrane isolation and protein extraction:

    • Carefully isolate bacterial inner membranes following protein expression

    • Solubilize with 1% DDM (n-dodecyl β-D-maltoside) to maintain protein-protein interactions

  • Validation controls:

    • Include parallel samples with unmodified YidC and YidC-BirA (non-mutant) to distinguish specific from non-specific biotinylation

    • Visualize biotinylated proteins by both SDS-PAGE and Western Blot detection

  • Affinity purification optimization:

    • Use NeutrAvidin beads for isolation of biotinylated proteins

    • Implement stringent washing procedures to reduce background

  • MS/MS analysis parameters:

    • Perform replicate experiments (minimum four biological replicates)

    • Rank identified proteins based on spectral counts

    • Focus on proteins consistently detected across replicates

Using this optimized approach, researchers identified 172 proteins across four replicates, with 21 proteins found consistently across all samples . This methodology successfully identified both previously known YidC interactors (FtsH, HflK, HflC) and novel partners like YibN, validating its effectiveness .

For Leptospira-specific studies, researchers should consider additional modifications to account for the unique molecular biology of this spirochete, particularly regarding growth conditions and membrane composition.

What expression systems yield the highest functional activity for recombinant Leptospira YidC?

Optimizing expression systems for recombinant Leptospira YidC requires balancing protein yield with retention of functional activity. Based on experimental studies with YidC from various bacterial species, the following parameters should be considered:

Comparison of expression systems for recombinant YidC production:

Expression SystemAdvantagesLimitationsFunctional RetentionBest Applications
E. coli pBAD22/pBAD33Inducible with arabinose (0.1%), high yieldPotential inclusion body formationHigh when expressed at room temperatureFunctional studies, BioID experiments
E. coli with C-terminal His-tagSimplified purificationTag may interfere with C-terminal interactionsModerate to high depending on tag positionStructural studies, binding assays
Cell-free systemsAvoids toxicity issuesLower yield, higher costHigh, preserves native foldingDifficult-to-express variants

For functional studies of Leptospira YidC, an E. coli expression system with arabinose-inducible promoters has proven effective, particularly when expression is conducted at room temperature rather than 37°C . This temperature adjustment helps maintain the proper folding and membrane integration of the recombinant protein.

When designing constructs, special attention should be paid to the cytoplasmic α-helical hairpin domain, which has been identified as the most flexible region of the insertase and appears in all YidC homologs . This domain plays a critical role in substrate binding and insertion, and its proper folding is essential for functional activity.

For researchers specifically interested in Leptospira interrogans serovar copenhageni YidC, optimizing codon usage for E. coli expression and implementing a two-step purification protocol combining affinity chromatography and size exclusion has yielded functionally active protein suitable for both structural and functional studies.

How can researchers experimentally distinguish between YidC-only and YidC-Sec dependent substrates in Leptospira?

Differentiating between substrates that require only YidC and those dependent on the coordinated action of YidC and the Sec translocase is methodologically challenging but crucial for understanding membrane protein biogenesis in Leptospira. Several experimental approaches can be employed:

Genetic depletion studies:

  • Construct conditional expression strains where either YidC or Sec components can be selectively depleted

  • Monitor insertion efficiency of candidate substrates under different depletion conditions

  • A substrate showing insertion defects only when YidC is depleted (not when Sec is depleted) likely represents a YidC-only substrate

Substrate characteristic analysis:

  • YidC-only pathway substrates typically contain short translocated regions followed by one or two transmembrane segments

  • Negative charges on the substrate N-terminal region or transmembrane segment have been proposed as YidC-only pathway determinants

  • Systematically modify these features in test substrates to assess pathway dependency

Co-expression experiments:
Results from co-expression studies reveal a pattern for identifying YidC-dependent substrates. When YibN (a YidC interactor) was co-expressed with various substrates, the following observations were made:

  • YidC substrates (M13 procoat, Pf3 coat, F0c) showed significantly increased synthesis

  • Non-YidC dependent substrates (YajC, YhcB) showed no change in biogenesis when co-expressed with YibN

  • SecG (topologically similar to F0c) showed increased biogenesis with YibN co-expression, suggesting YidC involvement

This differential response to YibN co-expression provides a novel experimental approach to categorize substrates.

Hydrophobicity-based screening:
The hydrophobicity of transmembrane segments appears important in determining YidC dependency. When SecG with mutation I20E in the first transmembrane segment was tested, it showed reduced YibN effect compared to wild-type SecG, indicating that transmembrane segment hydrophobicity influences YidC pathway utilization .

By combining these approaches, researchers can develop a comprehensive understanding of which Leptospira membrane proteins follow the YidC-only versus YidC-Sec dependent pathways.

What biophysical techniques best characterize the kinetics of YidC-substrate interactions in real-time?

Real-time characterization of YidC-substrate binding and insertion kinetics requires sophisticated biophysical techniques that can capture transient events occurring on millisecond timescales. The following methodologies have proven particularly valuable:

Combined single-molecule force spectroscopy and fluorescence spectroscopy:
This integrated approach has provided unprecedented insights into the temporal dynamics of YidC-mediated insertion. Studies revealed a two-phase process:

  • Rapid initial binding phase (within 2 ms): YidC's cytoplasmic α-helical hairpin binds substrate polypeptides with high conformational variability

  • Transition phase (within 52 ms): YidC strengthens binding and transfers substrate to the membrane-inserted state

Förster resonance energy transfer (FRET):
By strategically placing fluorescent donor-acceptor pairs on YidC and substrate proteins, researchers can monitor conformational changes and binding events in real-time. This approach is particularly valuable for tracking the relative movement of different YidC domains during substrate processing.

Surface plasmon resonance (SPR):
When adapted for membrane proteins using supported lipid bilayers or nanodiscs, SPR provides quantitative binding kinetics, including association/dissociation rates and binding constants between YidC and various substrates.

Molecular dynamics simulations:
Computational approaches complementing experimental techniques have helped elucidate how YidC facilitates substrate insertion through membrane thinning and hydrophobic interactions . These simulations provide mechanistic details difficult to capture experimentally.

For optimal results, researchers should consider implementing multiple complementary techniques, as each provides different insights into the complex dynamics of YidC-substrate interactions.

How does substrate hydrophobicity influence YidC-mediated insertion efficiency, and what are the experimental implications?

Substrate hydrophobicity has emerged as a critical determinant of YidC-mediated insertion efficiency, with significant implications for experimental design and interpretation. Multiple lines of evidence demonstrate this relationship:

Experimental evidence of hydrophobicity effects:
Co-expression studies with SecG variants revealed that mutation I20E in the first transmembrane segment significantly reduced the enhancement effect of YibN (a YidC interactor) compared to wild-type SecG . This observation directly links transmembrane segment hydrophobicity to YidC-dependent insertion efficiency.

Mechanistic basis for hydrophobicity influence:
The primary substrate contact sites of YidC are hydrophobic residues found in TM3 and TM5, which bind substrate transmembrane segments through hydrophobic interactions . This creates a "greasy-sliding mechanism" where substrate transmembrane domains interact with complementary hydrophobic surfaces in YidC .

Experimental considerations for researchers:

  • Substrate selection: When designing experiments to study YidC function, carefully consider the hydrophobicity profile of selected substrates

  • Hydrophobicity manipulation: Systematic mutation of hydrophobic residues in transmembrane segments provides a powerful approach to probe insertion mechanisms

  • Quantification methods: Ensure detection methods can accurately quantify insertion efficiency across substrates with varying hydrophobicity profiles

  • Buffer conditions: Solubilization conditions must be optimized for substrates with different hydrophobicity characteristics

  • Prediction tools: Computational prediction of YidC dependency should incorporate transmembrane segment hydrophobicity as a key parameter

For Leptospira interrogans research specifically, cataloging the hydrophobicity profiles of native membrane proteins could help predict which proteins likely require YidC for efficient insertion, guiding more targeted experimental approaches.

How do recombinant Leptospira outer membrane proteins compare to YidC as potential diagnostic targets?

When evaluating recombinant Leptospira proteins for diagnostic applications, outer membrane proteins have been extensively studied while YidC has received less attention. A comparative analysis reveals important considerations for researchers:

Comparative analysis of recombinant Leptospira proteins for diagnostics:

ProteinSensitivity (Acute Phase)Sensitivity (Convalescent)SpecificityCross-reactivityTechnical Considerations
rLipL3256%94%95%13% with VDRL+ sera, 23% with Lyme diseaseHighest sensitivity among tested Leptospira proteins
rOmpL116%72%90-97%*Limited dataShows dose-dependent response in ELISA
rLipL4124%44%90-97%*Limited dataLess effective than LipL32 and OmpL1
rHsp5818%32%90-97%*Limited dataPositive correlation with antigen concentration up to 100 ng/well
rLipL36Not significantNot significantN/AN/AExpression downregulated during infection
YidCNot determinedNot determinedNot determinedNot determinedPotential novel target, requires evaluation

*Range of specificities against different control groups

The recombinant LipL32 IgG ELISA demonstrated the highest diagnostic utility with 56% sensitivity during the acute phase and 94% during convalescence . This performance substantially exceeds other tested recombinant proteins including OmpL1, LipL41, and Hsp58 .

  • Its location in the inner membrane (less accessible to antibodies)

  • High conservation across bacterial species (potential cross-reactivity)

  • Relatively low abundance compared to major outer membrane proteins

For researchers considering YidC as a diagnostic target, initial studies should focus on:

  • Determining immunogenicity in natural infections

  • Assessing conservation across Leptospira serovars

  • Evaluating potential cross-reactivity with other spirochetes and common pathogens

What methodological approaches can determine if YidC inhibition represents a viable therapeutic strategy against leptospirosis?

Investigating YidC as a potential therapeutic target against Leptospira interrogans requires systematic assessment of its essentiality, druggability, and the consequences of its inhibition. Researchers should consider the following methodological framework:

Essentiality assessment:

  • Conditional expression systems: Develop inducible expression systems to control YidC levels in Leptospira and determine if depletion affects viability

  • CRISPR interference: Implement CRISPRi to temporarily repress YidC expression and monitor effects on growth and infectivity

  • Transposon mutagenesis: Perform saturating transposon mutagenesis followed by high-throughput sequencing to identify essential genes, including YidC

Structure-based drug design approach:

  • Homology modeling: Develop accurate structural models of Leptospira YidC based on homologous structures

  • Binding pocket identification: Analyze potential binding pockets, focusing on the conserved hydrophilic groove and substrate interaction sites

  • Differential targeting: Identify unique structural features that distinguish Leptospira YidC from human homologs to minimize off-target effects

Functional inhibition screening:

  • In vitro translation-translocation assays: Develop cell-free systems to test compounds for YidC inhibition

  • Fluorescence-based insertion assays: Monitor insertion of fluorescently-labeled YidC substrates in the presence of potential inhibitors

  • Growth inhibition correlation: Determine if growth inhibition correlates with biochemical measures of YidC inhibition

Validation in infection models:

  • Cell culture models: Assess inhibitor effects on Leptospira infection of host cells

  • Animal model studies: Evaluate therapeutic efficacy in established animal models of leptospirosis

  • Resistance development: Assess the frequency and mechanisms of resistance development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.