Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Leptospira interrogans Serovar Copenhageni NADH-Quinone Oxidoreductase Subunit K (nuoK)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Copenhageni NADH-quinone oxidoreductase subunit K (nuoK) is a His-tagged, full-length protein (1–106 amino acids) derived from the pathogenic bacterium L. interrogans. This subunit belongs to Complex I (NADH dehydrogenase) of the bacterial electron transport chain, playing a critical role in energy production via proton translocation and ATP synthesis .

Key Features

AttributeSpecification
Gene NamenuoK (LIC_12749)
UniProt IDQ72NT0
Expression HostEscherichia coli
Protein LengthFull-length (106 amino acids)
TagN-terminal His tag
Purity>90% (SDS-PAGE)
FormLyophilized powder (Tris/PBS buffer, 6% trehalose, pH 8.0)
Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)

Role in Bacterial Physiology

nuoK is a component of NADH-quinone oxidoreductase (Complex I), a multi-subunit enzyme essential for:

  • Electron transfer: Transfers electrons from NADH to ubiquinone.

  • Proton pumping: Drives ATP synthesis via proton translocation .

  • Pathogenicity: Complex I’s activity may influence Leptospira survival in host environments.

Recombinant Protein Production

ParameterDetail
Expression SystemE. coli (His-tag for purification)
YieldOptimized for high yield (exact values not disclosed)
PurificationAffinity chromatography (His-tag) followed by SDS-PAGE verification
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); glycerol (5–50%) recommended for storage

Stability and Handling

  • Storage: Lyophilized powder stored at -20°C/-80°C.

  • Aliquoting: Required for multiple uses to prevent degradation.

  • Reconstitution: Avoid repeated freeze-thaw cycles; store working aliquots at 4°C for ≤1 week .

Genomic Context of Serovar Copenhageni

Genomic studies highlight L. interrogans serovar Copenhageni as a prevalent member of the Icterohaemorrhagiae serogroup, with distinct genetic markers (e.g., indels in lic12008) separating it from Icterohaemorrhagiae strains . These differences underscore the importance of studying serovar-specific proteins like nuoK for tailored therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoK; LIC_12749; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
nuoK
Target Protein Sequence
MNHFISGIPIHYYLILAMIIFTIGVAGVMVRRSAVLIFMSVELILNSVNLVFVTFSKALH QIDGEVVVFFVMAIAAAEAAIGLAIVIAIHRIKKTSYVDEMNLMKW
Uniprot No.

Target Background

Function
NDH-1, a NADH-quinone oxidoreductase subunit K (nuoK), facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This process couples redox reactions with proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of NADH-quinone oxidoreductase subunit K in Leptospira interrogans?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of respiratory complex I in Leptospira interrogans, functioning in the electron transport chain that generates energy through oxidative phosphorylation. In pathogenic Leptospira species, this protein contributes to cellular metabolism and energy production, which is essential for bacterial survival during infection processes. The nuoK subunit is membrane-embedded and participates in proton translocation across the bacterial membrane, directly impacting the organism's ability to generate ATP under various environmental conditions. Genomic analysis of Leptospira interrogans serovar Copenhageni reveals a competent transport system with multiple gene families encoding major transporters, reflecting the organism's adaptation for survival in diverse environments .

How does the genome organization of Leptospira interrogans serovar Copenhageni influence expression of respiratory chain components?

The genome organization of L. interrogans serovar Copenhageni is characterized by genes that are not typically arranged in operons as seen in other bacteria, but rather scattered throughout chromosome I . This dispersed gene arrangement influences the regulation and expression of respiratory chain components like nuoK. The genome contains an extensive array of genes encoding regulatory systems, signal transduction proteins, and methyl-accepting chemotaxis proteins, which collectively enable the organism to respond to diverse environmental stimuli . This genomic architecture allows for complex regulation of respiratory chain genes, including nuoK, potentially providing adaptive advantages during host infection or environmental persistence.

What are the optimal conditions for expressing recombinant nuoK protein from Leptospira interrogans?

Expression of recombinant nuoK protein from Leptospira interrogans requires careful optimization due to its hydrophobic nature as a membrane protein. Based on approaches used for similar leptospiral proteins, the recommended protocol involves:

  • Gene amplification using high-fidelity polymerase with primers containing appropriate restriction sites

  • Cloning into an expression vector with a solubility-enhancing tag (MBP or SUMO)

  • Expression in E. coli BL21(DE3) or C43(DE3) strains specifically designed for membrane proteins

  • Induction with 0.1-0.5 mM IPTG at lower temperatures (16-20°C) overnight

  • Cell lysis with detergent-containing buffers (1% n-dodecyl-β-D-maltoside or CHAPS)

This methodology draws upon successful approaches used for extracting membrane proteins from Leptospira, similar to techniques employed in extracting the 72kDa protein where sequential protein extraction was performed to isolate hydrophobic membrane fractions .

What purification strategies are most effective for recombinant nuoK protein?

Purification of recombinant nuoK protein requires a multi-step approach to obtain sufficient purity for functional and structural studies:

Purification StepTechniqueBuffer ConditionsExpected Results
Initial CaptureIMAC (Ni-NTA)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 10-250 mM imidazole gradient70-80% purity
IntermediateIon Exchange20 mM phosphate pH 7.4, 50-500 mM NaCl gradient, 0.05% detergent85-90% purity
PolishingSize Exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.02% detergent>95% purity

Critical considerations include maintaining detergent concentrations above CMC (critical micelle concentration) throughout all purification steps and incorporating 10% glycerol to stabilize the protein. This approach is informed by successful purification strategies used for other membrane proteins from Leptospira interrogans and can be modified based on protein-specific characteristics.

How can researchers validate the functional integrity of purified recombinant nuoK?

Validation of purified recombinant nuoK functional integrity requires multiple complementary approaches:

  • Spectroscopic Analysis: UV-visible spectroscopy to detect characteristic absorbance of bound cofactors

  • NADH Oxidation Assay: Measuring NADH oxidation rates using artificial electron acceptors like ferricyanide

  • Proton Translocation Measurement: Using pH-sensitive fluorescent dyes in reconstituted proteoliposomes

  • Electron Transfer Kinetics: Stopped-flow spectroscopy to determine electron transfer rates

  • Thermal Stability Assessment: Differential scanning fluorimetry to evaluate protein stability

Mass spectrometry analysis should be used to confirm protein identity, similar to the approach used for the 72kDa heat shock protein DnaK in Leptospira interrogans, where significance homology matching was employed to validate protein identification . Additionally, circular dichroism spectroscopy can assess secondary structure integrity, particularly important for membrane proteins like nuoK.

How can structural studies of nuoK contribute to understanding Leptospira pathogenesis?

Structural studies of nuoK provide critical insights into Leptospira pathogenesis through several mechanisms:

  • Membrane Architecture: As a membrane protein, nuoK's structure reveals aspects of the bacterial membrane organization that influence interactions with host cells and environmental persistence.

  • Energy Metabolism During Infection: Structural characterization of nuoK elucidates how Leptospira maintains energy production during different stages of infection, particularly under oxygen-limited conditions encountered in host tissues.

  • Drug Target Identification: High-resolution structures of nuoK can reveal unique structural features that differentiate it from host homologs, facilitating rational drug design for anti-leptospiral compounds.

  • Functional Domains: Identifying conserved and variable domains within nuoK across pathogenic and non-pathogenic Leptospira species helps determine which structural elements correlate with virulence.

The genome features of Leptospira interrogans serovar Copenhageni include numerous genes related to toxins, lipoproteins, and surface-exposed proteins , and understanding how respiratory chain components like nuoK interact with these virulence factors is crucial for developing a comprehensive model of pathogenesis.

What approaches can be used to study nuoK interactions with other respiratory complex components?

Studying nuoK interactions with other respiratory complex components requires specialized techniques for membrane protein complexes:

  • Blue Native PAGE: To preserve native protein complexes and identify stable subcomplexes containing nuoK

  • Chemical Cross-linking combined with Mass Spectrometry (XL-MS): To capture transient interactions and map proximity relationships

  • Co-immunoprecipitation with antibodies against nuoK or other complex I components

  • Förster Resonance Energy Transfer (FRET): To study dynamics of protein interactions in reconstituted systems

  • Cryo-electron microscopy: For structural characterization of the entire respiratory complex

Additionally, bacterial two-hybrid systems modified for membrane proteins can be employed to screen for interaction partners. These methodological approaches should account for the challenging nature of membrane protein complexes and may require optimization of detergent conditions to maintain complex integrity.

How does nuoK contribute to Leptospira's adaptation to different environmental conditions?

NADH-quinone oxidoreductase subunit K plays a crucial role in Leptospira's adaptation to varying environmental conditions through its functions in energy metabolism:

  • Oxygen Concentration Adaptation: nuoK's involvement in the respiratory chain allows modulation of electron transport efficiency under different oxygen availabilities encountered during transmission and infection cycles.

  • pH Stress Response: As a proton-pumping component, nuoK contributes to maintenance of proton motive force under acidic or alkaline conditions.

  • Temperature Variation Response: The respiratory chain reconfigures during temperature shifts between environmental (ambient) and host (37°C) temperatures, with nuoK function potentially regulated during this adaptation.

  • Nutrient Limitation Survival: During nutrient limitation, efficient energy conservation through optimized respiratory chain function becomes critical for survival.

The Leptospira interrogans genome contains a broad array of genes encoding regulatory systems and signal transduction proteins that reflect the organism's ability to respond to diverse environmental stimuli , suggesting sophisticated regulation of respiratory components like nuoK during adaptation to different conditions.

Can recombinant nuoK be used as a diagnostic marker for leptospirosis?

While research on nuoK as a specific diagnostic marker is not detailed in the search results, its potential can be evaluated based on studies of other Leptospira proteins:

The 72kDa protein (heat shock protein DnaK) of Leptospira interrogans demonstrated significant diagnostic potential with 83.3% sensitivity and 95.2% specificity for detecting anti-leptospiral IgM antibodies . Its recombinant form (r72SEQ) maintained high diagnostic value (85% sensitivity, 81% specificity) . Similarly, nuoK could be evaluated as a diagnostic antigen through:

  • Assessment of nuoK immunogenicity during natural infection

  • Determination of antibody response profiles (IgM/IgG) against nuoK in acute and convalescent sera

  • Evaluation of cross-reactivity with antibodies from related infections

  • Development of ELISA, lateral flow, or immunoblot assays using recombinant nuoK

For optimal diagnostic utility, recombinant nuoK would need to demonstrate specificity for pathogenic Leptospira serovars and elicit a detectable immune response during early infection stages.

What challenges exist in developing recombinant nuoK-based vaccines against leptospirosis?

Development of recombinant nuoK-based vaccines faces several significant challenges:

  • Membrane Protein Presentation: As a hydrophobic membrane protein, nuoK is difficult to express in properly folded form and present appropriate epitopes to the immune system.

  • Conservation vs. Variability: While core respiratory proteins are conserved, surface-exposed regions may vary between serovars, potentially limiting cross-protection across the >250 Leptospira serovars worldwide .

  • Immune Response Type: Determining whether nuoK primarily elicits humoral or cell-mediated immunity is crucial for vaccine formulation decisions.

  • Adjuvant Requirements: Identifying appropriate adjuvants to enhance immunogenicity without causing adverse reactions.

  • Stability and Delivery: Maintaining structural integrity of recombinant nuoK during vaccine formulation, storage, and delivery.

Given these challenges, combination approaches incorporating nuoK with other immunogenic proteins (like heat shock protein DnaK or outer membrane proteins LipL32, LipL41, or OmpL1 ) may provide more effective protection against leptospirosis.

How can inhibitors targeting nuoK be evaluated for antimicrobial potential against Leptospira?

Evaluation of nuoK inhibitors as potential antimicrobials against Leptospira requires a systematic approach:

Evaluation StageMethodologyParameters MeasuredSuccess Criteria
Primary ScreeningEnzymatic assays with purified nuoKNADH oxidase activity inhibitionIC₅₀ < 10 μM
Secondary ScreeningWhole-cell growth inhibitionMIC against pathogenic LeptospiraMIC < 5 μg/mL
Selectivity AssessmentHuman cell toxicity assaysCC₅₀ against human cell linesSelectivity index > 10
Mechanism ValidationMembrane potential measurementProton motive force disruptionDose-dependent reduction
Resistance DevelopmentSerial passage with sub-MICResistance frequency< 10⁻⁸ at 4× MIC

Additional considerations include pharmacokinetic properties, in vivo efficacy in animal models, and activity against biofilm forms of Leptospira. The compound's ability to target multiple Leptospira serovars should be assessed, considering that more than 250 serovars have been identified worldwide with 37 isolated in Malaysia alone .

What are the main challenges in expressing hydrophobic membrane proteins like nuoK from Leptospira?

Expression of hydrophobic membrane proteins like nuoK presents several technical challenges:

  • Toxicity to Expression Host: Overexpression of membrane proteins often impairs E. coli membrane integrity, leading to toxicity and poor growth.

  • Inclusion Body Formation: Hydrophobic proteins frequently aggregate into inclusion bodies, requiring complex refolding procedures.

  • Post-translational Modifications: Leptospira proteins may undergo post-translational modifications not replicated in E. coli, potentially affecting function. Post-translational modification has been reported in Leptospira , which could impact recombinant protein properties.

  • Proper Membrane Insertion: Ensuring correct membrane insertion and topology is difficult in heterologous systems.

  • Low Yield: Membrane proteins typically express at lower levels than soluble proteins.

Solutions include using specialized E. coli strains (C41/C43), codon optimization for Leptospira genes, fusion with solubility-enhancing tags, and expression at reduced temperatures with lower inducer concentrations. Additionally, alternative expression systems like Leptospira-derived cell-free systems might better preserve native folding and modifications.

How can researchers address data inconsistencies when characterizing recombinant nuoK activity?

When encountering data inconsistencies in recombinant nuoK characterization, researchers should implement the following structured troubleshooting approach:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE and western blotting

    • Confirm identity using mass spectrometry as done for the 72kDa protein

    • Assess homogeneity using size exclusion chromatography

  • Experimental Condition Standardization:

    • Control detergent concentration precisely

    • Maintain consistent pH and ionic strength

    • Use internal controls for each experimental batch

  • Technical Variation Analysis:

    • Implement biological and technical replicates

    • Use statistical tools to identify outliers

    • Quantify variation sources through ANOVA

  • Method Validation:

    • Verify assay linearity and dynamic range

    • Establish minimum detectable activity levels

    • Perform spike-recovery tests with known standards

  • Alternative Methodology Comparison:

    • Use orthogonal techniques to measure the same parameter

    • Compare activity measurement methods (spectroscopic vs. electrochemical)

    • Cross-validate findings with native membrane preparations

Inconsistencies often arise from detergent effects on membrane proteins, so systematic evaluation of different detergent types and concentrations is especially important for nuoK characterization.

What quality control measures ensure reproducibility in nuoK functional studies?

Ensuring reproducibility in nuoK functional studies requires implementing comprehensive quality control measures:

  • Protein Characterization Documentation:

    • Detailed purity assessment (>95% by SDS-PAGE)

    • Complete mass spectrometry confirmation of sequence

    • Secondary structure verification by circular dichroism

  • Standardized Activity Benchmarks:

    • Establish reference activity values with standard deviation

    • Use consistent substrate batches and buffer preparations

    • Include positive controls in each experimental series

  • Environmental Parameter Control:

    • Temperature monitoring during all reactions (±0.5°C)

    • Oxygen levels measurement for oxidase activity assays

    • pH verification before and after reactions

  • Data Reporting Standards:

    • Raw data preservation and accessibility

    • Detailed methodological documentation including all buffer components

    • Statistical analysis transparency with appropriate tests

  • Cross-Laboratory Validation:

    • Inter-laboratory standardization of protocols

    • Reference sample exchange between research groups

    • Collaborative validation of critical findings

Implementation of electronic laboratory notebooks with standardized templates for nuoK experiments facilitates consistent documentation. Additionally, development of reference recombinant nuoK preparations with defined activity parameters would provide valuable benchmarks for quality control across different studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.