Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
kdpC; LIC_10992; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
kdpC
Target Protein Sequence
MIFLNIISISIRLLLILTLITGILYPIVTTGFAERFFPFRSSGSRVVIQGKIVGSELIAQ KFIKDEYFWPRPSAMDYAAGASNASVTNVFLKAKVEERKKFLLEKHSEQTQVPPDLLFAS GSGLDPHISPDSALFQINRVAKSRKLTEGQILRLKNIVEESVEKGYIGENRINVLLLNLK LDSEFGIILK
Uniprot No.

Target Background

Function

This protein is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is kdpC and what is its role in Leptospira interrogans?

KdpC is a subunit of the high-affinity potassium uptake system KdpABC, which functions as a P-type ATPase potassium transporter in Leptospira interrogans . It forms part of the membrane-associated complex that enables potassium transport across the bacterial membrane, particularly under conditions of potassium limitation. The kdpC protein of L. interrogans serogroup Icterohaemorrhagiae serovar copenhageni is 190 amino acids in length and functions as the potassium-binding and translocating subunit C within this complex .

How is the kdp system regulated in Leptospira interrogans?

The kdp system in L. interrogans is regulated by a two-component system consisting of the KdpD sensor kinase and the KdpE response regulator. When potassium levels are low, KdpD phosphorylates KdpE, which then acts as a positive regulator of kdpABC transcription . This regulatory mechanism is similar to that observed in Escherichia coli but with leptospira-specific characteristics. Research by Murray et al. demonstrated that a kdpE mutation in L. interrogans prevented the increase in kdpABC mRNA levels typically observed in wild-type strains under low potassium conditions .

What are the best methods for expressing and purifying recombinant kdpC protein?

For recombinant expression and purification of kdpC from L. interrogans, several effective methodologies have been established:

  • Expression Systems: The most successful expression has been achieved using E. coli expression systems with histidine-tag fusion constructs . Alternative expression hosts include yeast and baculovirus systems, each with specific advantages depending on experimental requirements .

  • Purification Protocol:

    • Transform expression vector containing kdpC gene into appropriate E. coli strain

    • Induce protein expression with IPTG at optimal concentration (typically 0.5-1 mM)

    • Lyse cells using appropriate buffer systems containing protease inhibitors

    • Purify using nickel affinity chromatography for His-tagged constructs

    • Consider additional purification steps (ion exchange, size exclusion chromatography) for higher purity

    • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability

  • Verification: Confirm successful expression and purification using SDS-PAGE and Western blotting with anti-His antibodies or kdpC-specific antibodies. Mass spectrometry can provide additional validation.

How can I design experiments to study kdpC regulation and function?

To investigate kdpC regulation and function in Leptospira interrogans, several experimental approaches have proven valuable:

  • β-galactosidase Reporter Systems: The methodology developed by Murray et al. using chromosomal genetic fusions to the endogenous bgaL gene of L. biflexa provides a robust system for studying regulatory factors affecting kdpC expression . This approach involves:

    • Creating translational fusions of kdpC promoter regions to the β-galactosidase gene

    • Introducing these constructs into L. biflexa

    • Measuring β-galactosidase activity under various conditions to assess expression levels

  • Gene Knockout and Complementation:

    • Use transposon mutagenesis or targeted gene disruption to create kdpC mutants

    • Complement mutants with wild-type kdpC to confirm phenotypic restoration

    • Analyze growth characteristics under various potassium concentrations

  • Expression Analysis:

    • Real-time PCR to quantify kdpC mRNA levels under different conditions

    • Western blotting to assess protein levels

    • Immunofluorescence microscopy to examine cellular localization

What techniques can be used to assess the functional role of kdpC in potassium transport?

Several methodologies are available to investigate the functional role of kdpC in potassium transport:

  • Growth Assays: Compare growth of wild-type and kdpC mutant strains in media with defined potassium concentrations. This approach can reveal the impact of kdpC on bacterial survival under potassium limitation.

  • Potassium Uptake Assays:

    • Use radioactive potassium (⁴²K) to measure uptake rates

    • Employ potassium-selective electrodes to monitor extracellular potassium depletion

    • Utilize fluorescent potassium indicators to track intracellular potassium concentrations

  • Membrane Potential Measurements: Fluorescent voltage-sensitive dyes can be used to assess changes in membrane potential associated with potassium transport activity.

  • ATPase Activity Assays: Since kdpC is part of a P-type ATPase, measure ATP hydrolysis rates in membrane preparations or with purified protein complexes.

How can I investigate the interaction between kdpC and other Kdp complex components?

To study protein-protein interactions within the Kdp complex:

  • Co-immunoprecipitation: Using antibodies against kdpC or epitope tags to pull down protein complexes and identify interacting partners.

  • Bacterial Two-Hybrid System: This approach can reveal direct protein-protein interactions between kdpC and other components of the Kdp system.

  • Cross-linking Studies: Chemical cross-linking followed by mass spectrometry can identify interaction interfaces between kdpC and other subunits.

  • Site-directed Mutagenesis: Systematic mutation of key residues can identify those critical for complex assembly and function, revealing important interaction sites. Analysis of the data from these experiments typically involves:

    MutationEffect on Complex FormationEffect on ATPase ActivityEffect on K⁺ Transport
    S45AMinimal effectReduced by 15%Reduced by 20%
    R67ESeverely disruptedReduced by 85%Not detectable
    D112AModerate disruptionReduced by 40%Reduced by 60%
    K148AMinimal effectReduced by 10%Minimal effect

    Note: This table provides hypothetical data for illustrative purposes based on typical experimental outcomes.

What is the relationship between kdpC expression and virulence in Leptospira interrogans?

The relationship between kdpC expression and virulence remains an active area of research. Methodological approaches to investigate this relationship include:

  • Animal Infection Models: Compare virulence of wild-type and kdpC mutant strains in established animal models of leptospirosis, typically using hamsters or guinea pigs .

  • Transcriptomic Analysis: RNA-seq or microarray studies comparing gene expression profiles between virulent and avirulent strains, with particular focus on kdp locus expression.

  • Host Cell Interaction Assays:

    • Adhesion assays to host cells

    • Invasion assays

    • Intracellular survival assays

    • Measurement of inflammatory mediators

  • In vivo Expression Technology (IVET): To identify genes, including potentially kdpC, that are specifically upregulated during infection.

How do genomic variations in the kdp locus differ between pathogenic Leptospira serovars?

Genomic analysis of the kdp locus across Leptospira serovars reveals important evolutionary insights:

  • Comparative Genomics Approach:

    • Whole genome sequencing of multiple isolates

    • Alignment of kdp locus sequences

    • Identification of SNPs and indels

    • Phylogenetic analysis

  • Structure-Function Correlations: Map sequence variations to protein structure models to predict functional implications.

  • Expression Comparison: Quantitative PCR and promoter activity assays to determine if sequence variations correlate with expression differences.

Studies have shown that while serovars Copenhageni and Icterohaemorrhagiae are closely related, they display distinct genetic features . Genomic comparison studies have identified SNPs and indels that can differentiate between these serovars, though specific differences in the kdp locus require further investigation.

How can I overcome solubility issues when working with recombinant kdpC protein?

As a membrane protein, kdpC presents particular challenges for recombinant expression and purification:

  • Optimization Strategies:

    • Use solubility-enhancing fusion tags (MBP, SUMO, thioredoxin)

    • Express truncated versions lacking transmembrane domains

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Include appropriate detergents during purification (e.g., n-dodecyl-β-D-maltoside, CHAPS)

  • Refolding Approaches: If expressed as inclusion bodies, develop refolding protocols using gradual dialysis methods.

  • Alternative Expression Systems: Consider cell-free expression systems or specialized E. coli strains designed for membrane protein expression.

What controls should be included when studying kdpC regulation using reporter systems?

When implementing reporter systems to study kdpC regulation, several controls are essential:

  • Negative Controls:

    • Empty vector controls

    • Non-regulated promoter fusions (e.g., constitutive promoters)

    • Mutant kdpC promoter lacking regulatory elements

  • Positive Controls:

    • Known regulated promoters (e.g., lipL32 promoter in Murray et al.'s study )

    • Artificially inducible promoter systems

  • Validation Controls:

    • Multiple independent clones to rule out positional effects

    • qRT-PCR confirmation of reporter activity correlating with native gene expression

    • Complementary approaches (e.g., Western blotting, transcriptomics)

What are the emerging techniques for studying potassium transporter systems in pathogenic bacteria?

Several cutting-edge approaches show promise for advancing our understanding of bacterial potassium transporters:

  • Cryo-Electron Microscopy: This technique can provide high-resolution structural insights into the entire Kdp complex, including conformational changes during the transport cycle.

  • Single-Molecule Tracking: To observe the dynamics of Kdp complex assembly and localization within bacterial membranes.

  • CRISPR-Cas9 Genome Editing: More precise genetic manipulation to introduce subtle mutations or regulatory element modifications.

  • Microfluidics-Based Approaches: For real-time monitoring of bacterial responses to changing potassium concentrations at the single-cell level.

  • Systems Biology Integration: Combining transcriptomics, proteomics, and metabolomics data to create comprehensive models of potassium homeostasis networks.

How might understanding kdpC function contribute to novel therapeutic strategies against leptospirosis?

The potential therapeutic applications of kdpC research include:

  • Drug Target Validation:

    • Essentiality studies under infection-relevant conditions

    • Structural analysis to identify druggable pockets

    • High-throughput screening for inhibitors

  • Vaccine Development:

    • Evaluation of recombinant kdpC as a potential vaccine antigen

    • Assessment of protective immunity in animal models

    • Combination with other leptospiral antigens for broader protection

  • Diagnostic Applications:

    • Development of PCR-based assays targeting kdp locus for detection and typing

    • Recombinant kdpC-based serological assays

    • Point-of-care diagnostic tools

Studies with other bacterial pathogens suggest that disruption of potassium homeostasis can severely compromise bacterial viability and virulence, making the Kdp system a promising therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.