Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni UPF0316 protein LIC_12973 (LIC_12973)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LIC_12973; UPF0316 protein LIC_12973
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Target Names
LIC_12973
Target Protein Sequence
MFFQRYLYCMEFSFPLPGNPIFDYVLLPCFIFLSRVTDVSIGTIRVILLTREKKGIAASL GFLEVLLWVVVITQVIKNLNNVFCYLAYAGGFATGTFIGMILEEKLAIGFSLLRIISPQN GSEIADKLSEAGYRVTIMNGHGSRGPVKIVFTVLKRKKIDQAMKIVQNVEPDVFYSIENA RRTNTTTFEDSPGLLRRGILEKILKIRK
Uniprot No.

Target Background

Database Links
Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Leptospira interrogans and what is the significance of serogroup Icterohaemorrhagiae serovar copenhageni?

Leptospira interrogans is a pathogenic spirochete that causes leptospirosis, a zoonotic infection with worldwide distribution. The bacterium is considered an emerging and re-emerging threat, particularly in relation to climate change events such as heavy rainfall and flooding, which can trigger outbreaks of leptospirosis . The serogroup Icterohaemorrhagiae serovar copenhageni represents a specific antigenic variant of L. interrogans that has particular epidemiological significance. This serovar is commonly associated with rats as reservoir hosts, though these host-serovar associations are not absolute . Understanding the specific characteristics of this serovar is crucial for epidemiological studies and the development of preventive strategies against leptospirosis.

How should recombinant LIC_12973 be stored and handled for optimal stability?

For optimal stability, recombinant LIC_12973 should be stored at -20°C, and for extended storage, it is recommended to keep it at either -20°C or -80°C . The protein is typically supplied in a Tris-based buffer with 50% glycerol, which has been optimized for this specific protein . Researchers should note that repeated freezing and thawing cycles can compromise protein integrity and functionality. Therefore, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw cycles . These storage conditions are crucial for maintaining protein stability and ensuring reproducible experimental results.

What expression systems are most suitable for producing recombinant LIC_12973?

While the search results do not specify the exact expression system used for LIC_12973, researchers should consider several factors when selecting an appropriate system:

The choice should be guided by the intended use of the protein and the structural requirements for maintaining its native properties. Researchers should also consider codon optimization for the selected expression system to enhance protein yield .

What functional genomics approaches can be employed to study LIC_12973?

Functional genomics approaches can significantly advance our understanding of LIC_12973's role in Leptospira biology. These approaches include:

  • Gene Knockdown/Knockout Studies: RNAi or CRISPR-Cas9 systems can be employed to modulate LIC_12973 expression and observe phenotypic changes in Leptospira . This approach can provide insights into the protein's role in bacterial survival, virulence, or host interaction.

  • Transcriptomic Analysis: RNA-Seq can be used to identify conditions under which LIC_12973 is differentially expressed, potentially indicating its functional context.

  • Protein-Protein Interaction Studies: Techniques such as co-immunoprecipitation or yeast two-hybrid assays can identify interaction partners of LIC_12973, offering clues to its function.

  • High-Content Screening: Automated microscopy and image analysis can be used to assess changes in bacterial morphology or behavior in response to LIC_12973 modulation .

Each of these approaches requires careful experimental design and appropriate controls to yield reliable and interpretable results. The choice of method should be guided by the specific research question and available resources.

How can researchers validate the identity and purity of recombinant LIC_12973?

To ensure experimental reproducibility and reliability, researchers should validate both the identity and purity of recombinant LIC_12973 using multiple complementary techniques:

  • SDS-PAGE: To assess protein purity and approximate molecular weight.

  • Western Blotting: Using antibodies specific to the protein or to affinity tags if present.

  • Mass Spectrometry: For definitive identification and to confirm the absence of post-translational modifications or degradation.

  • Size Exclusion Chromatography: To evaluate protein homogeneity and detect aggregation.

  • Circular Dichroism: To verify proper protein folding.

  • Functional Assays: If known, functional properties of LIC_12973 should be verified.

These validation steps are essential before proceeding with complex experiments to ensure that observed effects are attributable to LIC_12973 rather than contaminants or improperly folded protein.

What is known about the potential role of LIC_12973 in Leptospira pathogenesis?

While the specific role of LIC_12973 in Leptospira pathogenesis remains largely uncharacterized, several lines of evidence can guide research in this area:

  • The protein belongs to the UPF0316 family, which includes proteins from other pathogenic bacteria. Comparative analysis with these homologs might provide functional insights.

  • Other UPF0316 proteins have been associated with virulence in different bacterial species, suggesting a potential role for LIC_12973 in Leptospira pathogenicity .

  • The expression of certain prophage regions in Leptospira has been linked to pathogenicity, with expression being down-regulated in avirulent strains . Investigating whether LIC_12973 expression correlates with virulence could provide valuable insights.

  • Recent research has highlighted the importance of leucine-rich repeat (LRR) proteins in Leptospira virulence . Although LIC_12973 is not specifically identified as an LRR protein in the search results, examining whether it shares structural features or functional properties with these proteins could be informative.

Systematic studies comparing the expression and function of LIC_12973 between pathogenic and non-pathogenic Leptospira strains would be valuable for elucidating its role in pathogenesis.

How might LIC_12973 interact with host immune components?

Understanding the interaction between LIC_12973 and host immune components is crucial for elucidating its potential role in pathogenesis. Current knowledge suggests several avenues for investigation:

  • Pattern Recognition Receptors: TLR2 and TLR4 have been identified as necessary for effective innate immune control of Leptospira infection . Researchers should investigate whether LIC_12973 interacts with these receptors, potentially using recombinant proteins in binding assays or cell culture models.

  • Humoral Immunity: The natural host immune response to leptospirosis is mediated largely through humoral mechanisms, with protective antibodies directed mainly toward leptospiral lipopolysaccharide (LPS) . Determining whether LIC_12973 elicits an antibody response during infection could indicate its surface exposure and immunogenicity.

  • Immune Evasion: Many bacterial proteins facilitate immune evasion. Experiments testing LIC_12973's ability to interfere with complement activation, phagocytosis, or other immune mechanisms would be valuable.

Research has shown that recombinant Leptospira proteins can be recognized by antibodies in leptospirosis serum samples, suggesting their expression during infection . Similar studies with LIC_12973 would provide evidence for its in vivo expression and potential role during infection.

What comparative genomics approaches can be used to predict LIC_12973 function?

Comparative genomics offers powerful tools for predicting protein function, particularly for uncharacterized proteins like LIC_12973:

  • Phylogenetic Analysis: Constructing phylogenetic trees of UPF0316 proteins across bacterial species can reveal evolutionary relationships and potential functional conservation.

  • Synteny Analysis: Examining the genomic context of LIC_12973 across Leptospira species may provide clues to its function, as functionally related genes are often co-located.

  • Structural Prediction: Advanced bioinformatic tools can predict protein structure based on sequence, potentially revealing functional domains.

  • Clade-Specific Distribution: The distribution of LIC_12973 across Leptospira clades (P1, P2, S1, S2) could be informative. For instance, proteins found primarily in pathogenic clades (P1, P2) may have virulence-related functions .

A systematic analysis using these approaches could generate testable hypotheses about LIC_12973 function, guiding subsequent experimental validation.

What are common challenges in recombinant LIC_12973 expression and how can they be addressed?

Researchers may encounter several challenges when expressing recombinant LIC_12973:

ChallengePotential Solutions
Low expression yieldOptimize codon usage for the host organism; adjust induction conditions (temperature, inducer concentration, duration); try different promoters or expression vectors
Protein insolubilityExpress at lower temperatures (16-20°C); use solubility-enhancing fusion tags (MBP, SUMO); optimize buffer conditions; try detergents or mild denaturants
Protein degradationInclude protease inhibitors; express in protease-deficient host strains; optimize purification speed; adjust pH and ionic strength of buffers
Improper foldingCo-express with chaperones; use eukaryotic expression systems if post-translational modifications are required; try refolding protocols
Toxicity to host cellsUse tightly regulated inducible promoters; try cell-free expression systems; use lower growth temperatures

Addressing these challenges often requires an iterative approach, testing multiple conditions to identify optimal expression parameters for LIC_12973.

How should researchers interpret contradictory results in LIC_12973 functional studies?

When facing contradictory results in LIC_12973 functional studies, researchers should follow a systematic approach:

  • Validate Protein Quality: Ensure that all experiments use properly folded, pure protein by implementing rigorous quality control.

  • Examine Experimental Conditions: Small differences in buffer composition, temperature, or incubation times can significantly impact results.

  • Consider Strain Variability: LIC_12973 function may vary across different Leptospira strains. The protein is found primarily in the P1 subclade, with possible variations in other subclades .

  • Evaluate Detection Methods: Different detection methods have varying sensitivities and specificities, potentially leading to discrepant results.

  • Biological Context: LIC_12973 may have multiple functions depending on the biological context or experimental system.

A comprehensive table documenting experimental conditions across studies can help identify sources of variability and reconcile contradictory findings.

What controls are essential for experiments involving recombinant LIC_12973?

Robust experimental design requires appropriate controls to ensure valid and interpretable results:

Control TypePurposeExample
Positive ControlConfirms assay functionalityKnown interaction partner or ligand
Negative ControlEstablishes baseline/backgroundBuffer-only or irrelevant protein
Specificity ControlVerifies specific effectsCompetitive inhibition with excess unlabeled protein
Expression Vector ControlDifferentiates effects of the protein from effects of the expression systemEmpty vector or unrelated protein expressed in same system
Endotoxin ControlRules out effects of bacterial contaminantsEndotoxin-removed protein preparations or endotoxin inhibitors
Functional ValidationConfirms biological activitySite-directed mutagenesis of predicted functional residues

Additionally, when studying protein interactions, concentration-dependent binding experiments with saturation analysis provide evidence of specific interactions, as observed with other Leptospira proteins .

How might structural biology approaches advance our understanding of LIC_12973?

Structural biology approaches offer significant potential for elucidating LIC_12973 function:

  • X-ray Crystallography or Cryo-EM: Determining the three-dimensional structure of LIC_12973 could reveal structural motifs associated with specific functions.

  • NMR Spectroscopy: Can provide insights into protein dynamics and identify regions involved in ligand binding.

  • Molecular Dynamics Simulations: Using the determined structure, simulations can predict conformational changes and potential interaction sites.

  • Structure-Function Relationship Studies: Combining structural data with site-directed mutagenesis can validate predicted functional sites.

The amino acid sequence of LIC_12973 provided in the search results can serve as a starting point for structural predictions, guiding the design of mutations to test functional hypotheses.

What is the potential of LIC_12973 as a target for diagnostic or therapeutic development?

Several characteristics suggest LIC_12973 might have potential as a diagnostic or therapeutic target:

  • Diagnostic Applications: If LIC_12973 is demonstrated to be immunogenic and expressed during infection, it could serve as an antigen in diagnostic tests. Research has shown that recombinant Leptospira proteins can be recognized by antibodies in leptospirosis serum samples .

  • Vaccine Development: Understanding the contribution of LIC_12973 to pathogenesis could inform its potential as a vaccine component. Proteins that mediate adhesion to host tissues, as seen with certain Leptospira LRR proteins , are often good vaccine candidates.

  • Therapeutic Targeting: If LIC_12973 is found to be essential for Leptospira virulence or survival, it could be targeted by novel antimicrobials.

Development of ELISA-based detection systems using recombinant LIC_12973, similar to those available commercially , represents one practical application of this protein in diagnostic contexts.

How can systems biology approaches integrate LIC_12973 into broader pathogenesis models?

Systems biology offers frameworks for understanding how individual proteins like LIC_12973 contribute to complex biological processes:

  • Interaction Networks: Mapping the interaction partners of LIC_12973 can place it within cellular pathways and functional contexts.

  • Multi-omics Integration: Combining transcriptomic, proteomic, and metabolomic data can reveal how LIC_12973 expression correlates with various cellular states.

  • Host-Pathogen Interaction Models: Integrating data on LIC_12973 with host response information can elucidate its role in the infection process.

  • Comparative Systems Analysis: Comparing systems-level data between virulent and avirulent Leptospira strains can highlight the contribution of LIC_12973 to pathogenesis.

These approaches support the "pathogenomics" perspective mentioned in the search results , which couples high-throughput sequencing and bioinformatics comparisons of gene content to identify specific phenotypic changes that distinguish saprophyte from pathogen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.