Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Apolipoprotein N-acyltransferase 1 (lnt1)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference for your use.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development based on your specifications.
Synonyms
lnt1; LA_1124; Apolipoprotein N-acyltransferase 1; ALP N-acyltransferase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-576
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
lnt1
Target Protein Sequence
MFYNFISKDSILYRLILCFGIGIGTVFGLSPFSFFSAGVFASISCIFLFFSLNRTSIWKA
FLWLLILSQILNFTAFYWIPGAISRISGVNTFVSILFFFLYGLISHLKFFLFYTLFRFSK
IDSASKTYILLIFPAAGTLSDMITFQIFPWYWGNLISGSIVFEQFASICGVYGLSFLLLF
ISSTFLILVNYYKYKNSKEFKTSIASLICITFIYGFGLYRIGYINQSQNELKPKNLSVLM
IQPDTSPGTKDLKADASYLSATMSKVFSLAIPTFENSPSLIVIPESAIPFHGTIDSEENR
KEKIYSSTMEGIILYLSKHTGADVLFNELNLDENKLRNQVSLFKNLDGKTERYNKRRLLP
FGEYLPMEKNFPFLRSIFQETSRYVPGEFPKLLIGNKIQNQRSFLPPEISKLNEPKTYRY
EFSSIVEHTNKIRNLEYSYSILPLLCYEAMFTELVLDYFQNEQKPEVLINITNDSWFDSE
LEAYQHSGAVRLRAIETGLPLIRSAVSGISEVWDARGIPMIVPIGFHETGTRAFSIRLDA
IESTIYTRFGNSFLWIFCILILISRLIFVSRIERKS
Uniprot No.
Target Background
Function
Apolipoprotein N-acyltransferase 1 (Lnt1) from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai is an enzyme that catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links
KEGG: lil:LA_1124
STRING: 189518.LA_1124
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
