Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Apolipoprotein N-acyltransferase 2 (lnt2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Leptospira interrogans Serogroup Icterohaemorrhagiae Serovar Lai Apolipoprotein N-Acyltransferase 2 (lnt2)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Apolipoprotein N-acyltransferase 2 (lnt2) is a genetically engineered protein expressed in Escherichia coli. This enzyme is part of the apolipoprotein N-acyltransferase family, involved in post-translational lipid modification of bacterial lipoproteins . The recombinant form retains the full-length sequence (1-595 amino acids) of the native protein, fused with an N-terminal His tag for purification and detection purposes .

Genomic Context and Pathogenic Relevance

Leptospira interrogans serovar Lai belongs to the Icterohaemorrhagiae serogroup, a highly virulent strain associated with severe leptospirosis . The lnt2 gene (LA_4078) is conserved among pathogenic Leptospira species but absent in non-pathogenic counterparts (e.g., L. biflexa) . Comparative genomic studies reveal that:

  • LIC12008 frameshift mutation: A key genetic marker distinguishing serovar Copenhageni from Icterohaemorrhagiae, though lnt2 remains conserved .

  • Functional role: Likely involved in lipoprotein maturation, essential for membrane integrity and host-pathogen interactions .

Comparative Genomic Features

FeatureSerovar Lai (lnt2)Serovar Copenhageni (lnt2)
Gene IDLA_4078LIC_13250
UniProt IDQ8EYY4Q72MD8
SNP FrequencyLowLow
Indel ImpactNone reportedNone reported

Diagnostic and Vaccine Development

Recombinant lnt2 has potential utility in:

Key Challenges

  • Cross-reactivity: Polyclonal antibodies against LRR proteins (e.g., LIC11051, LIC11505) may cross-react with lnt2 due to conserved domains .

  • Functional validation: In vivo studies are needed to confirm its role in virulence or immune evasion .

Production and Quality Control

ParameterSpecification
Expression SystemE. coli
PurificationAffinity chromatography (His tag)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C for 1 week

Future Directions

  • Functional studies: Elucidate substrate specificity and role in lipid metabolism.

  • Immunogenicity trials: Evaluate recombinant lnt2 as a subunit vaccine component .

  • Structural analysis: Resolve 3D conformation to identify druggable sites .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lnt2; LA_4078; Apolipoprotein N-acyltransferase 2; ALP N-acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
lnt2
Target Protein Sequence
MDTLHHRFQQFQKTIWFNIFCYLWTGIFSFLAFAPVSLTHFVWIAPFGFFWLSLKYHGKY KKLFFHGLLIGVVFYAISFHWIIHMAITFGNFPYVVAILILLFAGLLFGLKFPIFMMSFS FLSGKIGRHSVWVAGFCGLLSELIGPQLFPWYWGNLAAGNIILAQNAEITGVYGISFLVF IVSYTLFQSNPWHWKEIIHSKEKRKQYLRFITLPALLLLTFIVSGIFLFKKWENVKPVKS LNVLIVQPDAPLSFRDGREIKESIEALMARIEKLTDEGAVRLGKKPDLIVLPEAGVPFFS AHKTEITTKVRRMYWDRFDSLMFLLANRYKANVFFNEIDAGFKGAPSPRNLRYYNNNVLY DPNGDRRDSYQKKFLLMFGEYMPFDFLYELSQQTGRFEPGLTHNLIRYYTPRYYTLAEKE KSPKGRHLGWTDTETFNHEAVRSYYETTRTEVSETGKFLPLICYEVILPEFVREFRTAGN PEFIVNLTNDKWYGATTESDQHMELGRLRSIELRRWMVRSTNSGISANIDHLGRFVGNKK TGLMTAEALSETIDVIDSPPTFYTQYGNLIPWLMLFLTGIYYLNLLIGIRRGKSA
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links

KEGG: lil:LA_4078

STRING: 189518.LA_4078

Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase 2 (lnt2) and what is its role in Leptospira?

Apolipoprotein N-acyltransferase 2 (lnt2) is an integral membrane enzyme that belongs to the nitrilase superfamily. In Leptospira and other Gram-negative bacteria, it plays a crucial role in the post-translational modification of lipoproteins, specifically catalyzing the final step of lipoprotein maturation. Lnt2 is responsible for the N-acylation of the terminal cysteine residue of apolipoproteins, forming the mature lipoprotein that is essential for bacterial cell envelope integrity and function .

The enzyme operates via a proposed two-step ping-pong mechanism: first, acyl transfer from a phospholipid substrate creates a thioester linkage on the active site cysteine; second, the acyl chain transfers from this cysteine to the N-terminal cysteine of the apolipoprotein . This process is unique to Gram-negative bacteria and is essential for their survival, making Lnt2 a potential target for antimicrobial development.

How does Lnt2 differ structurally and functionally from other acyltransferases in bacteria?

Lnt2 has distinctive structural features that set it apart from other bacterial acyltransferases. Based on sequence similarity, it belongs to the nitrilase superfamily, characterized by a catalytic Glu-Lys-Cys triad that hydrolyzes carbon-nitrogen bonds . The crystal structure of Lnt reveals two primary conformational states:

  • An acyl-intermediate state with a thioester linkage at the active site

  • An apo-state with an open substrate entry portal

A key structural element is the W237 residue, which undergoes significant movement triggered by substrate binding. This movement appears to direct and stabilize the interaction between Lnt and the incoming substrate apolipoprotein . Unlike other acyltransferases, Lnt2 has a unique membrane-embedded structure with an arm that extends parallel to the membrane, which is critical for its function in the bacterial envelope.

What are the typical expression systems used for producing recombinant Lnt2?

The most commonly used expression system for recombinant Lnt2 is Escherichia coli, particularly for producing His-tagged versions of the protein. The recombinant full-length Leptospira interrogans serogroup Icterohaemorrhagiae Apolipoprotein N-acyltransferase 2 protein (spanning amino acids 1-595) is typically expressed with an N-terminal His tag in E. coli systems .

This expression system offers several advantages:

Expression SystemAdvantagesConsiderations
E. coliHigh yield, established protocols, cost-effectiveMay require optimization of growth conditions
Mammalian cellsBetter post-translational modificationsMore expensive, lower yield
Insect cellsGood for membrane proteinsRequires specialized expertise

For Lnt2 specifically, E. coli expression systems have proven effective for producing functional protein that can be purified via affinity chromatography using the His tag .

How do conformational changes in Lnt2 affect its catalytic efficiency and substrate specificity?

The catalytic efficiency and substrate specificity of Lnt2 are intimately linked to its conformational dynamics. Crystal structures reveal that Lnt2 undergoes significant conformational changes during its catalytic cycle. In one crystal form, two molecules were observed in the asymmetric unit, with one molecule showing the thioester acyl-intermediate and the other suggesting a potential apolipoprotein docking mode .

A critical element in this conformational change is the movement of the essential W237 residue. This residue appears to act as a molecular switch that is triggered by substrate binding . When the substrate binds, W237 moves to help direct and stabilize the interaction between Lnt2 and the incoming apolipoprotein substrate. This movement creates a suitable environment for the catalytic reaction to proceed efficiently.

The substrate entry portal also shows remarkable plasticity. In the apo-state, this portal is completely open and devoid of bound molecules, despite crystallization in a lipidic cubic phase. This suggests that the enzyme can accommodate various substrate sizes and configurations, potentially explaining its ability to process different apolipoproteins .

What are the challenges in distinguishing the activities of different Lnt isoforms in pathogenic Leptospira strains?

Distinguishing the activities of different Lnt isoforms (such as Lnt1 and Lnt2) in pathogenic Leptospira presents several significant challenges:

  • Overlapping substrate specificities: Both enzymes may act on similar apolipoprotein substrates, making it difficult to attribute specific activities to each isoform.

  • Functional redundancy: In some pathogenic Leptospira strains, there may be partial functional redundancy between different Lnt isoforms, complicating the analysis of knockout or inhibition studies.

  • Strain-specific variations: Different serovars of Leptospira interrogans (such as Lai vs. Copenhageni) may exhibit variations in Lnt sequence and regulation, requiring strain-specific characterization .

  • Technical limitations: The membrane-bound nature of Lnt enzymes makes them challenging to study in isolation while maintaining their native conformation and activity.

To overcome these challenges, researchers typically employ a combination of approaches:

ApproachApplicationLimitation
Gene knockoutDetermine essentialityPossible lethality if essential
CRISPR/Cas9 editingTargeted mutationsTechnical difficulty in Leptospira
Selective inhibitorsDistinguish isoform activityLimited availability of specific inhibitors
Heterologous expressionIsolate individual isoform activityMay not reflect native behavior

Recent advances in gene-editing technologies like CRISPR/Cas9 offer promising tools for investigating these distinctions more precisely .

How does the efficiency of Lnt2-mediated lipoprotein processing correlate with Leptospira virulence?

The correlation between Lnt2-mediated lipoprotein processing and Leptospira virulence is a complex relationship that remains an active area of research. Several key observations suggest a strong connection:

  • Lipoproteins are essential components of the bacterial cell envelope and are responsible for many functions critical to pathogenesis, including adhesion, immune evasion, and nutrient acquisition.

  • The final maturation step of lipoproteins, catalyzed by Lnt2, is unique to Gram-negative bacteria and is essential for proper lipoprotein localization and function .

  • In clinical cases of leptospirosis, serological tests detecting antibodies against Leptospira lipoproteins (such as LipL32) are used for diagnosis, indicating that these lipoproteins are immunogenic during infection .

  • Pathogenic strains of Leptospira generally express a distinct profile of lipoproteins compared to non-pathogenic strains, suggesting their importance in virulence.

The efficiency of Lnt2-mediated processing may affect virulence through several mechanisms:

  • Proper localization of adhesins necessary for host colonization

  • Correct formation of transporters required for nutrient acquisition during infection

  • Appropriate assembly of immune evasion factors that protect against host defenses

Mutations or inhibition of Lnt2 could potentially attenuate virulence by disrupting these processes, making this enzyme a viable target for therapeutic intervention.

What are the optimal conditions for expressing and purifying recombinant Lnt2 while maintaining its native conformation?

The expression and purification of recombinant Lnt2 while preserving its native conformation requires careful optimization of several parameters:

Expression Conditions:

  • Host system: E. coli is typically used for expressing recombinant Lnt2 with an N-terminal His tag

  • Growth temperature: Lower temperatures (16-25°C) during induction often improve proper folding

  • Induction parameters: IPTG concentration and induction duration must be optimized

  • Media composition: Enriched media may improve yield while maintaining proper folding

Purification Protocol:

  • Cell lysis should be performed gently, typically using detergent-based methods suitable for membrane proteins

  • Affinity chromatography using the His tag is the primary purification step

  • Buffer conditions are critical - typical buffers include Tris/PBS-based systems at pH 8.0 with added stabilizers like trehalose (6%)

  • Detergent selection is crucial for maintaining native conformation of this membrane protein

Storage Considerations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles that can damage the protein

  • Addition of glycerol (5-50% final concentration) helps maintain stability during freezing

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

Maintaining Lnt2 in its native conformation is particularly challenging due to its membrane-associated nature. The use of appropriate detergents during purification and storage is essential, as is minimizing exposure to conditions that might disrupt the protein's structure.

What are the most reliable assays for measuring Lnt2 enzymatic activity in vitro?

Several assays have been developed to reliably measure Lnt2 enzymatic activity in vitro, each with specific advantages and limitations:

1. Thioester Intermediate Detection Assay
This assay monitors the formation of the thioester acyl-intermediate on the active site cysteine, which represents the first step of the ping-pong mechanism . The presence of this intermediate can be detected by:

  • Mass spectrometry to identify the acylated peptide

  • Chemical trapping followed by Western blotting

  • Spectroscopic methods that detect changes in the environment of the active site cysteine

2. Complete Reaction Assay
This approach measures the full reaction by monitoring the transfer of the acyl group to the apolipoprotein acceptor:

  • Using radiolabeled phospholipid substrates and detecting transfer to the apolipoprotein

  • Mass spectrometry of the apolipoprotein to detect mass changes corresponding to acylation

  • Fluorescently labeled substrates that change properties upon transfer

3. Coupled Enzyme Assays
These assays link Lnt2 activity to another easily measurable enzymatic reaction:

  • Release of free fatty acids can be coupled to acyl-CoA synthetase and monitored spectrophotometrically

  • Changes in phospholipid composition can be monitored using phospholipase-coupled assays

Assay TypeAdvantagesLimitationsSensitivity
Thioester IntermediateDirectly measures first catalytic stepDoes not confirm complete reactionHigh
Complete ReactionMeasures physiologically relevant outcomeMore complex setupModerate to High
Coupled EnzymeContinuous monitoring possiblePotential interference from coupling enzymesHigh

When selecting an assay, researchers should consider the specific aspect of Lnt2 function they wish to investigate and the available instrumentation.

How can researchers effectively develop and validate inhibitors targeting Lnt2 from Leptospira interrogans?

Developing and validating inhibitors targeting Lnt2 from Leptospira interrogans requires a systematic approach:

Target Validation

  • Confirm essentiality of Lnt2 in Leptospira through conditional knockdown or knockout studies

  • Verify that inhibition of Lnt2 activity affects bacterial viability or virulence

  • Ensure that the target is sufficiently different from host enzymes to allow selective inhibition

Inhibitor Discovery Strategies

  • Structure-based design: Utilize crystal structures of Lnt2 to identify potential binding sites

  • High-throughput screening: Test compound libraries against purified recombinant Lnt2

  • Fragment-based approach: Identify small molecules that bind to Lnt2 and optimize their properties

  • Natural product screening: Test extracts for Lnt2 inhibitory activity

In Vitro Validation

  • Enzyme inhibition assays: Measure the effect of compounds on Lnt2 enzymatic activity

  • Binding studies: Confirm direct interaction using techniques like isothermal titration calorimetry

  • Selectivity profiling: Test against related enzymes to ensure specificity

  • Structure-activity relationship studies: Optimize potency and selectivity

Cellular Validation

  • Growth inhibition assays: Test effect on Leptospira growth in culture

  • Lipidomic analysis: Monitor changes in lipoprotein processing

  • Resistance development studies: Assess potential for resistance emergence

In Vivo Validation

  • Animal models of leptospirosis: Test efficacy in reducing bacterial burden or disease severity

  • Pharmacokinetic and toxicity studies: Ensure suitable drug-like properties

  • Combination studies: Evaluate synergy with existing antibiotics

The critical step in this process is establishing a reliable correlation between Lnt2 inhibition and reduced bacterial viability or virulence, as this validates the target for therapeutic intervention.

How can recombinant Lnt2 be incorporated into vaccine development strategies against leptospirosis?

Recombinant Lnt2 can be strategically incorporated into vaccine development against leptospirosis through several approaches:

  • Proper folding of recombinant Lnt2 to preserve critical epitopes

  • Appropriate adjuvant selection to enhance immunogenicity

  • Delivery methods that maximize antigen presentation

2. DNA Vaccine Approaches
DNA vaccines encoding Lnt2 can be developed, similar to approaches used with other Leptospira antigens such as LipL32. Research has shown that DNA vaccines targeting conserved proteins in pathogenic Leptospira can induce protective immune responses . For Lnt2-based DNA vaccines:

  • Codon optimization for mammalian expression is essential

  • The full-length gene or immunogenic fragments can be incorporated into expression vectors

  • Prime-boost strategies combining DNA vaccines with protein boosters may enhance efficacy

3. Multi-Epitope Vaccine Design
Lnt2 can be incorporated into chimeric multi-epitope vaccines that combine T and B cell epitopes from multiple Leptospira antigens. This approach has shown promise with other Leptospira proteins :

Vaccine TypeComponentsAdvantagesChallenges
r4R chimeric vaccineMultiple T and B cell epitopesEnhanced immune responseComplex design required
Lnt2-LipL32-OmpL1 fusionCombined conserved proteinsBroader protectionProper folding concerns
Live vector expressing Lnt2Attenuated carrier with Lnt2Strong cellular immunitySafety considerations

4. Adjuvant and Delivery System Optimization
Regardless of the vaccine platform chosen, optimizing the delivery of recombinant Lnt2 is crucial:

  • Liposomal formulations may enhance immune responses to membrane-associated proteins

  • Toll-like receptor agonists can boost innate immune activation

  • Nanoparticle-based delivery systems can improve antigen stability and presentation

Based on research with similar Leptospira antigens, recombinant Lnt2 vaccines would likely need to induce both humoral and cellular immune responses for optimal protection against leptospirosis .

What are the critical considerations when designing CRISPR/Cas9 gene editing experiments targeting Lnt2 in Leptospira?

Designing effective CRISPR/Cas9 gene editing experiments targeting Lnt2 in Leptospira requires careful attention to several critical factors:

Guide RNA (gRNA) Design

  • Target specificity: Ensure the gRNA is specific to Lnt2 with minimal off-target effects

  • Efficiency considerations: Select target sites with predicted high editing efficiency

  • PAM availability: Identify accessible protospacer adjacent motif (PAM) sites in the Lnt2 gene

  • Functional domains: Target conserved catalytic regions (such as the Glu-Lys-Cys catalytic triad) for knockout studies

Delivery Methods

  • Transformation efficiency: Leptospira has relatively low transformation efficiency, requiring optimized protocols

  • Vector systems: Select appropriate vectors that can function in Leptospira

  • Transient vs. stable expression: Determine whether transient or stable expression of Cas9 is more suitable

Experimental Controls

  • Positive controls: Include targets with known high editing efficiency in Leptospira

  • Negative controls: Use non-targeting gRNAs to assess background effects

  • Complementation: Prepare complementation constructs to verify phenotype specificity

Verification Strategies

  • Genomic validation: Design PCR primers flanking the target site to verify editing

  • Protein expression analysis: Confirm Lnt2 knockout at the protein level

  • Functional assays: Assess lipoprotein processing in edited strains

  • Whole genome sequencing: Check for off-target effects or compensatory mutations

Phenotypic Characterization

  • Growth kinetics: Monitor growth in various media and conditions

  • Stress responses: Assess sensitivity to environmental stresses

  • Virulence testing: Evaluate virulence in appropriate animal models

  • Lipoprotein processing: Analyze changes in lipoprotein profiles

Recent research has demonstrated the application of CRISPR/Cas technology in Leptospira, including the development of an RPA CRISPR/Cas12a detection platform for identifying pathogenic Leptospira strains . This technology showed impressive sensitivity (85.2%), specificity (100%), and accuracy (92.7%) in clinical studies, suggesting that CRISPR systems can be effectively applied to Leptospira research .

How can structural information about Lnt2 be leveraged to understand resistance mechanisms against antimicrobial compounds?

Structural information about Lnt2 provides valuable insights for understanding potential resistance mechanisms against antimicrobial compounds targeting this enzyme:

1. Active Site Architecture Analysis
The crystal structures of Lnt reveal key details about its active site, including the catalytic Glu-Lys-Cys triad characteristic of the nitrilase superfamily . This information allows researchers to:

  • Identify residues critical for catalysis that might be subject to mutation

  • Map the substrate binding pocket to predict how alterations might affect inhibitor binding

  • Understand the conformational changes that occur during catalysis, which might be modified in resistant strains

2. Resistance Mutation Prediction
Based on structural data, researchers can predict likely resistance mutations:

  • Mutations at or near the active site that preserve catalytic function but alter inhibitor binding

  • Alterations in residues controlling access to the active site, such as those in the substrate entry portal

  • Changes in the W237 residue or other residues involved in conformational changes during substrate binding

3. Allosteric Site Identification
Beyond the active site, structural analysis can reveal allosteric sites where:

  • Mutations might occur that alter enzyme dynamics without affecting the primary catalytic mechanism

  • Conformational changes could be modified to maintain function while evading inhibitor action

  • Protein-protein interactions critical for function might be altered

4. Structural Basis for Cross-Resistance
Understanding the structural relationships between different Lnt variants can help predict cross-resistance patterns:

  • Comparing Lnt2 structures from different Leptospira serovars to identify conserved and variable regions

  • Analyzing structural similarities with Lnt enzymes from other bacterial species to predict cross-species resistance profiles

  • Identifying structural features that might confer selective resistance to certain classes of inhibitors

5. Rational Design of Resistance-Evading Inhibitors
Structural information can guide the design of inhibitors less prone to resistance:

  • Targeting multiple binding sites simultaneously

  • Designing inhibitors that interact with highly conserved structural elements unlikely to tolerate mutation

  • Creating compounds that maintain binding despite changes in protein conformation

The conformational changes observed in different crystal forms of Lnt, particularly the movement of W237 and the dynamics of the substrate entry portal , provide crucial information about the enzyme's flexibility. This flexibility may contribute to the development of resistance by allowing the enzyme to adapt to inhibitors while maintaining its essential function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.