Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leptospira interrogans Serogroup Icterohaemorrhagiae Serovar Lai Cobalamin Synthase (cobS)

Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai cobalamin synthase (cobS) is a recombinant protein derived from the pathogenic bacterium Leptospira interrogans. This enzyme participates in the cobalamin (vitamin B₁₂) biosynthesis pathway, a critical metabolic process for microbial survival. The recombinant form of cobS is engineered for research applications, including enzymatic studies, diagnostic assays, and drug target evaluation.

Protein Architecture

cobS is a 265-amino acid (aa) protein (Uniprot ID: Q8EYK8) with a molecular weight of approximately 28.5 kDa (calculated from sequence). Key structural features include:

  • Tagging: Produced with an N-terminal His-tag for purification via metal affinity chromatography .

  • Domain Organization: Contains conserved motifs associated with enzymatic activity in the cobalamin biosynthesis pathway, though specific catalytic residues require further characterization.

  • Stability: Optimized for storage in Tris-based buffers with 50% glycerol at -20°C to preserve activity .

Biochemical Role

cobS functions as part of the de novo cobalamin biosynthesis pathway, which is essential for bacterial survival. In L. interrogans, this pathway includes multiple enzymes such as cobC, cobD, cbiP, and cobS, organized in operons on chromosome II . While the exact enzymatic step catalyzed by cobS remains undefined, its role aligns with cobalt insertion or corrinoid modification in B₁₂ synthesis.

Expression Systems and Yield

Recombinant cobS is typically expressed in Escherichia coli using plasmid-based systems. Key parameters include:

ParameterDetails
Expression HostE. coli (e.g., BL21(DE3))
TagN-terminal His-tag for affinity purification
PurificationNickel- or cobalt-based affinity chromatography
Storage BufferTris-based buffer (pH 7.4–8.0) with 50% glycerol to prevent degradation

Note: Repeated freeze-thaw cycles are discouraged to maintain structural integrity .

Application in Assays

Recombinant cobS is utilized in enzyme-linked immunosorbent assays (ELISA) for serological detection of anti-Leptospira antibodies. This application leverages the protein’s immunogenicity to identify infections in clinical or experimental settings .

Genomic Context and Pathogenicity

Genomic analyses of L. interrogans serovar Copenhageni and Lai identified cobalamin biosynthesis genes as potential drug targets . L. interrogans relies on de novo B₁₂ synthesis, contradicting earlier assumptions that it required exogenous B₁₂ . Disruption of cobS could impair bacterial survival, positioning it as a therapeutic target.

Comparative Pathway Analysis

The cobalamin pathway in L. interrogans differs from non-pathogenic Leptospira spp. in gene organization and regulatory elements. For instance, cobS is absent in saprophytic species like L. biflexa, while pathogenic strains retain a complete operon .

EnzymeFunctionPathogenic LeptospiraSaprophytic Leptospira
cobSCobalamin synthasePresent Absent
cobDCobalamin biosynthesis proteinPresent Present

Therapeutic and Diagnostic Potential

  • Drug Target: cobS’s role in B₁₂ synthesis makes it a candidate for antimicrobial development. Subtractive genomics identified 158 genes in L. interrogans serovar Lai as potential targets, including cobalamin-related enzymes .

  • Diagnostic Marker: Recombinant cobS is validated for serological testing, though cross-reactivity with other Leptospira serovars requires validation .

Challenges and Future Directions

  • Mechanistic Gaps: The precise catalytic role of cobS in cobalamin biosynthesis remains uncharacterized. Structural studies (e.g., X-ray crystallography) are needed to elucidate its biochemical function.

  • Vaccine Development: While cobS is not a primary vaccine candidate, its inclusion in multi-antigen vaccines could enhance coverage against diverse Leptospira serovars.

  • Therapeutic Inhibition: Small-molecule inhibitors targeting cobS’s active site may disrupt B₁₂ synthesis, offering a novel treatment strategy.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; LA_4205; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
cobS
Target Protein Sequence
MNKLQEEWNRFCASWMFNTRLPILPFYVYSESTLSRSSRYFPLIGWIVSAGTSYSTYFLS WILPIEISIILGMILSVLITGGFHEDGLADVCDAFGGGWSKEKILEIMKDSRIGTFGSIG LILSLGLKYLLLVNLFKISPWIFLFTSWFSHSASRWFALLLMMLIPYARENDLSKSKPMI KKLPPFDFALSTFFGCFPAVYFLYQFQNQIPNVLLGFFLSSIFVFYFRNYFNKWIEGFTG DCLGFIQQGTELLFYLGITVSWNSI
Uniprot No.

Target Background

Function

This recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Cobalamin synthase (CobS) catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.

Database Links

KEGG: lil:LA_4205

STRING: 189518.LA_4205

Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.