Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; LA_0178; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-627
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
yidC
Target Protein Sequence
MEDRQTRLFLALILSMGIWMGVNYFFFPNTSTKKNTETKQTQSDKTSENTKQQITSGKTK ESNSADPVVQKEKITPFDTKKSFIVTDSYIVEFSSLGGKISKFYMKDFTGPNGELIQVAR KNPETVVVDGKSYQAVELSRDKGFDFNFSDSLVEISDSPWNYIQFSLTEDKINHSISFSA VSPDRSYQLKKEFRFYPSENYFKLSISIINFSKEKLSFASQKNVRYLRTFGSLGPYPKDR PLSDRDTANFFRFYYLGGSFQDTLDGSSSVGFWSSVGNFFTGNSGTDESFSIKTDKESGV DFAGTGSRYFIAVADPLDHKPHGIVLDNRPKNESGAVLVYDNILLNPGENYNLDFASYIG IRESEGMAFKNPELDPSQSKNSPFVGLSSDLNKSFNQGITTPFRNGIIWILKQIYRFTIP NYGWSIIIFAILFKLVFYPLNQKQADSMKKMQELSPQLKTINEKFANDPKMRQQKTMELY KKNNVNPVGGCLPMVIQIPIFIALYTAFSDTIDLWNSPFLWVKDLSEPDVIWTSPAIPYF TQTGIGLNLLALLMVGTQVFQTRMTSVSMDPNQKMLMYVMPVMMLYIFWNMPSGVTLYWT FQNVLSIGQQWITNHLKKTEEKKKAKV
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links

KEGG: lil:LA_0178

STRING: 189518.LA_0178

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its significance in Leptospira interrogans serovar Lai?

YidC is a prominent member of the Oxa1 superfamily that plays an essential role in the biogenesis of the bacterial inner membrane, significantly influencing its protein composition and lipid organization . In Leptospira interrogans serovar Lai, YidC functions as a critical membrane protein insertase, helping to integrate proteins into the cytoplasmic membrane. The protein exhibits dual functionality: it can interact with the Sec translocon to aid in the proper folding of multi-pass membrane proteins, and it can also function independently as an insertase and lipid scramblase .

The significance of YidC in Leptospira interrogans lies in its fundamental role in membrane biology, which is essential for bacterial survival and pathogenicity. The proper insertion and folding of membrane proteins facilitated by YidC are crucial for various cellular processes, including nutrient transport, signal transduction, and interaction with host cells during infection. Understanding YidC's function provides insights into the basic biology of this pathogenic spirochete and potential targets for therapeutic intervention .

Leptospira interrogans serovar Lai contains complete secretion systems, including type I and type II secretion systems, as well as complete Sec translocase and Tat translocase systems, which work in concert with YidC to ensure proper protein translocation and membrane insertion .

How does YidC function as a membrane protein insertase?

YidC functions as a membrane protein insertase through a sophisticated mechanism that involves specific structural elements and a coordinated insertion process. The crystal structure of YidC reveals a coiled-coil domain in the cytoplasmic loop C1 and five core transmembrane α-helices that form a hydrophilic groove opening toward the cytoplasm and extending halfway through the lipid bilayer . This unique architecture is critical for its insertase function.

During the insertion process, the nascent amino-terminal hydrophilic segment of the substrate protein initially binds to the cytoplasmic loop C1, from which it is guided to the hydrophilic groove . This groove can accommodate hydrophilic segments of the nascent polypeptide, facilitating their translocation through the lipid membrane. Simultaneously, the hydrophobic transmembrane α-helices of the substrate interact with the "greasy slide" comprised of transmembrane α-helices III and V of YidC, which helps them ultimately insert into the membrane .

YidC can operate both in conjunction with the Sec translocon as part of the holo-translocon and independently to facilitate the insertion and folding of membrane proteins. When functioning independently, YidC typically handles smaller, single- or double-spanning membrane proteins, although it has been shown to promote the insertion and folding of more complex polytopic membrane proteins as well . The dual functionality of YidC as both an insertase and a chaperone ensures the proper integration and folding of membrane proteins, which is essential for maintaining membrane integrity and function.

What are the key experimental approaches for studying recombinant YidC in Leptospira interrogans?

Several key experimental approaches have proven effective for studying recombinant YidC in Leptospira interrogans. Researchers typically begin with gene cloning and recombinant protein expression, where the yidC gene from Leptospira interrogans serovar Lai is amplified, cloned into an appropriate expression vector, and expressed in a host system such as Escherichia coli. This is followed by protein purification using techniques like affinity chromatography with His-tagged constructs, which has been successfully employed to isolate YidC for further analysis .

Interaction studies are crucial for understanding YidC's functional networks. Proximity-dependent biotin labeling (BioID) has been utilized to identify proteins in close proximity to YidC, leading to the discovery of important interactors like YibN . Affinity purification-mass spectrometry (AP-MS) on native membranes has confirmed these interactions, while on-gel binding assays with purified proteins have provided additional validation .

Functional assays are essential for characterizing YidC's activity. Co-expression studies involving YidC and its substrates, such as phage coat proteins or ATP synthase subunits, help evaluate YidC's role in membrane protein insertion. In vitro assays using reconstituted proteoliposomes containing YidC allow researchers to assess its insertase activity in a controlled environment .

Structural analysis techniques, including X-ray crystallography and cryo-electron microscopy, have been valuable for elucidating YidC's three-dimensional structure, providing insights into its functional mechanisms. Additionally, single-molecule force spectroscopy has been employed to monitor how YidC guides the folding of polytopic membrane proteins into membranes, revealing the stepwise insertion and folding processes at a molecular level .

How does YidC in Leptospira interrogans compare with YidC homologs in other bacteria?

YidC in Leptospira interrogans shares significant structural and functional similarities with YidC homologs in other bacteria, particularly those in Gram-negative species, while also exhibiting some distinctive features that may reflect adaptation to Leptospira's unique physiology. YidC protein sequences in Gram-negative bacteria share high similarities of up to 99% , indicating strong evolutionary conservation of this essential insertase. This high degree of conservation underscores the fundamental importance of YidC's function across different bacterial species.

Recent research has identified YibN as a crucial interactor of YidC in Escherichia coli, significantly enhancing YidC's function in membrane protein insertion . Comparative studies investigating whether similar interactions exist in Leptospira interrogans could provide valuable insights into the evolutionary conservation or divergence of YidC's functional networks across bacterial species.

What is the role of YidC in the folding mechanics of complex membrane proteins, and how can it be experimentally verified?

YidC plays a sophisticated role in the folding mechanics of complex membrane proteins, acting as both an insertase and a molecular chaperone to ensure proper structural integration. For complex polytopic membrane proteins with multiple transmembrane segments, YidC facilitates a stepwise insertion and folding process that is critical for achieving the native conformation. Recent research has demonstrated that YidC guides the folding of polytopic membrane proteins by helping form stable folding cores and preventing misfolding, particularly in structurally complex regions that interface pseudo-symmetric α-helical domains .

Single-molecule force spectroscopy (SMFS) has emerged as a powerful technique for experimentally verifying YidC's role in membrane protein folding. This approach allows researchers to mechanically unfold membrane proteins and observe their refolding in real-time, with and without YidC. Studies using SMFS have revealed that complex transporters like the melibiose permease MelB form two independent folding cores during insertion, and YidC accelerates and chaperones each step of this process . Without YidC, the structural regions interfacing these folding cores show a high probability of misfolding, highlighting YidC's critical role in preventing aberrant conformations.

Complementary techniques for experimental verification include:

  • Conditional depletion studies in vivo, where YidC expression is controlled to observe the effects on membrane protein folding and function.

  • Reconstitution experiments combining purified YidC and substrate proteins in proteoliposomes to assess folding efficiency in vitro.

  • Site-directed mutagenesis of YidC functional domains to identify specific residues critical for chaperone activity.

  • Crosslinking studies to capture transient interaction states between YidC and substrate proteins during the folding process.

  • Comparative analysis of membrane protein structures obtained with and without YidC assistance, using techniques like cryo-electron microscopy.

How can protein-protein interaction networks involving YidC be comprehensively mapped in Leptospira interrogans?

Mapping the comprehensive protein-protein interaction networks involving YidC in Leptospira interrogans requires a multi-faceted approach combining complementary techniques to capture both stable and transient interactions. Proximity-dependent biotin labeling (BioID) has proven highly effective for identifying proteins in close proximity to YidC in bacterial systems . This technique involves fusing a biotin ligase to YidC, allowing it to biotinylate nearby proteins, which can then be isolated and identified by mass spectrometry. Applying this methodology to Leptospira interrogans would provide valuable insights into YidC's local protein environment under native conditions.

Affinity purification-mass spectrometry (AP-MS) approaches using tagged versions of YidC represent another powerful strategy. Studies have successfully employed His-tagged YidC in pulldown experiments, followed by SILAC-labeling with lysine isotopologues to quantitatively distinguish specific interactors from background proteins . When applied to Leptospira interrogans, this approach could identify stable interaction partners of YidC within the membrane proteome.

Cross-linking mass spectrometry (XL-MS) offers additional advantages for capturing transient or weak interactions that might be lost during conventional purification methods. By using chemical cross-linkers to covalently link interacting proteins before isolation and analysis, researchers can preserve interaction networks that would otherwise be disrupted. This technique is particularly valuable for membrane protein complexes, which often form dynamic and context-dependent associations.

For validation of identified interactions, several complementary methods should be employed:

  • Reciprocal pulldown experiments to confirm bidirectional interactions

  • Co-immunoprecipitation with antibodies against native proteins

  • Bacterial two-hybrid assays to verify direct protein-protein interactions

  • Fluorescence resonance energy transfer (FRET) to observe interactions in living cells

  • Functional assays to assess the biological significance of identified interactions

What are the critical parameters for optimizing the expression and purification of recombinant YidC from Leptospira interrogans?

Optimizing the expression and purification of recombinant YidC from Leptospira interrogans presents several challenges due to its nature as a multi-spanning membrane protein. Critical parameters must be carefully controlled at each stage of the process to obtain functionally active protein in sufficient quantities for structural and functional studies.

For expression optimization, the choice of expression system is paramount. While E. coli is commonly used, specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results for challenging membrane proteins like YidC . The expression vector should include appropriate fusion tags (His6, FLAG, or SPA tags) that have been successfully used for YidC purification . Induction conditions require careful optimization, with lower temperatures (16-20°C) and reduced inducer concentrations often favoring proper folding over high-level expression. Membrane protein expression can be monitored using GFP fusion constructs, allowing rapid assessment of expression levels and proper membrane localization.

Membrane extraction represents a critical step that significantly impacts final protein quality. Gentle solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM), which has been successfully employed for YidC isolation , helps maintain protein structure and function. A detergent screening approach is advisable to identify optimal solubilization conditions for Leptospira YidC specifically.

Purification strategies typically involve multi-step chromatography approaches:

  • Immobilized metal affinity chromatography (IMAC) for initial capture of His-tagged YidC

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Ion exchange chromatography for final polishing and removal of contaminating proteins

Throughout purification, detergent concentration must be maintained above the critical micelle concentration to prevent protein aggregation. For functional studies, purified YidC can be reconstituted into proteoliposomes using E. coli polar lipid extracts or defined lipid mixtures that mimic the Leptospira membrane environment .

Quality control assessments should include SDS-PAGE, Western blotting, mass spectrometry, and functional assays to verify protein identity, purity, and activity. Thermal stability assays can provide valuable information about protein folding and stability in different buffer conditions.

What methodological approaches can resolve contradictory findings regarding YidC's substrate specificity in different bacterial species?

Resolving contradictory findings regarding YidC's substrate specificity across bacterial species requires systematic methodological approaches that address potential sources of experimental variability while enabling direct comparative analyses. A comprehensive substrate profiling strategy is essential, involving the selection of a diverse panel of potential YidC substrates, including both established substrates from model organisms and predicted substrates from Leptospira interrogans. These substrates should represent varying degrees of complexity, from small single-spanning proteins to large polytopic membrane proteins, to thoroughly evaluate specificity patterns .

Standardized in vivo insertion assays using conditional YidC depletion strains constructed in multiple bacterial species would allow direct comparison of YidC dependency across organisms. By expressing the same set of reporter substrates in these different genetic backgrounds, researchers can identify species-specific variations in YidC function. Complementation studies using YidC orthologs expressed in a common host system can further isolate species-specific effects from host cellular context factors .

Detailed biochemical characterization of YidC-substrate interactions using techniques such as surface plasmon resonance or microscale thermophoresis would provide quantitative binding parameters, potentially revealing differences in affinity or kinetics that could explain apparent contradictions in substrate recognition. These analyses should be performed under identical experimental conditions for YidC from different species to ensure valid comparisons.

Structural biology approaches, including cryo-electron microscopy of YidC-substrate complexes, could identify specific recognition elements and binding modes that differ between bacterial species. By capturing YidC in the act of inserting the same substrate across different species, researchers may identify structural adaptations that explain divergent substrate preferences .

Computational approaches including molecular dynamics simulations and bioinformatic analyses of co-evolutionary patterns between YidC and its substrates across bacterial phylogeny could reveal underlying principles of substrate recognition that reconcile apparently contradictory experimental findings.

An integrated data analysis framework incorporating results from these diverse methodological approaches would help distinguish genuine biological differences from experimental artifacts, potentially resolving contradictions by revealing context-dependent rules governing YidC substrate specificity across bacterial species.

What is the optimal experimental design for studying the interaction between YidC and the Sec translocon in Leptospira interrogans?

The optimal experimental design for studying the YidC-Sec translocon interaction in Leptospira interrogans requires a multi-technique approach that captures both structural associations and functional cooperation. A comprehensive experimental strategy should begin with genetic constructs that enable controlled expression of tagged versions of both YidC and SecYEG components in Leptospira. Complementary tagging strategies (e.g., His-tag on YidC and FLAG-tag on SecY) allow for reciprocal pulldown experiments to confirm interactions from both perspectives .

Co-immunoprecipitation studies using antibodies against native proteins provide valuable validation under physiological conditions, while blue native-PAGE analysis can preserve native membrane protein complexes for detection of the intact holo-translocon. For higher resolution structural insights, chemical crosslinking followed by mass spectrometry (XL-MS) can map specific contact points between YidC and Sec components, revealing the molecular architecture of the interaction interface.

Functional cooperation between YidC and the Sec translocon can be assessed through substrate insertion assays using model membrane proteins known to require both systems. By creating conditional depletion strains for either YidC or SecY, researchers can systematically evaluate how the absence of one component affects the activity of the other . Real-time monitoring of membrane protein insertion kinetics in reconstituted proteoliposomes containing purified YidC, SecYEG, or both would provide direct evidence of functional synergy or independence.

Site-directed mutagenesis of putative interaction domains, based on structural information from homologous systems, can identify critical residues mediating the YidC-Sec interaction. Complementation studies using these mutants would confirm their functional significance in vivo.

Advanced imaging techniques such as single-molecule fluorescence microscopy could track the dynamic association and dissociation of YidC and SecYEG in live cells, providing insights into the temporal aspects of their interaction during membrane protein biogenesis.

This multi-faceted experimental design addresses both structural and functional aspects of the YidC-Sec interaction, providing a comprehensive understanding of how these systems cooperate in Leptospira interrogans.

How can researchers troubleshoot common problems in YidC functional assays?

Researchers frequently encounter several challenges when conducting YidC functional assays that can significantly impact experimental outcomes. Understanding common problems and implementing systematic troubleshooting strategies is essential for obtaining reliable results. One frequent issue is poor expression of recombinant YidC, which can result from toxicity associated with membrane protein overexpression. This can be addressed by optimizing induction conditions (reducing temperature to 16-20°C, using lower inducer concentrations) or switching to specialized expression strains designed for membrane proteins .

Protein misfolding or aggregation during purification presents another common challenge. If analytical size exclusion chromatography reveals significant aggregation, researchers should optimize detergent selection through systematic screening, adjust buffer composition to include stabilizing agents like glycerol or specific lipids, and consider adding stabilizing mutations based on structural information . Maintaining detergent concentration above the critical micelle concentration throughout all purification steps is crucial for preventing aggregation.

For functional reconstitution assays, inconsistent proteoliposome formation can lead to variable results. This can be addressed by standardizing liposome preparation protocols, verifying proper protein orientation using protease protection assays, and confirming incorporation efficiency through density gradient centrifugation. The lipid composition should mimic the native membrane environment of Leptospira interrogans for optimal YidC activity.

In substrate insertion assays, false negatives may occur if the chosen substrates are not natural targets of YidC in Leptospira. Researchers should validate substrate selection through preliminary bioinformatic analyses and pilot experiments comparing YidC-dependent and independent membrane proteins . Optimizing the substrate:YidC ratio is also critical, as excess substrate can overwhelm the system while insufficient amounts may yield signals below detection limits.

For interaction studies, nonspecific binding during co-immunoprecipitation or pulldown experiments can obscure genuine interactions. Implementing stringent controls, including using untagged strains and irrelevant tagged proteins as references, helps distinguish specific interactions from background . SILAC labeling approaches, which allow quantitative discrimination between specific and nonspecific binding partners, have proven particularly effective for YidC interaction studies .

What are the best approaches for analyzing YidC-mediated membrane protein insertion kinetics?

Analyzing YidC-mediated membrane protein insertion kinetics requires sophisticated techniques that can capture the dynamic process of protein integration into lipid bilayers with high temporal resolution. Real-time fluorescence spectroscopy represents one of the most powerful approaches, utilizing fluorescently labeled substrate proteins to monitor insertion events as they occur. By strategically placing environment-sensitive fluorophores within the substrate protein, researchers can detect transitions from aqueous to lipid environments as insertion proceeds. This technique allows for continuous monitoring of insertion kinetics under various conditions, including different YidC concentrations, lipid compositions, or in the presence of potential inhibitors .

Single-molecule force spectroscopy (SMFS) provides unprecedented insights into the energy landscape of YidC-mediated insertion by mechanically manipulating individual protein molecules. This technique has revealed that YidC accelerates and chaperones the stepwise insertion and folding process of complex membrane proteins like MelB, with distinct effects on different structural regions . By comparing force-distance curves obtained with and without YidC, researchers can quantify its impact on folding kinetics and identify specific folding intermediates that depend on YidC's chaperone function.

Stopped-flow techniques offer another valuable approach for measuring rapid kinetics, particularly when combined with intrinsic tryptophan fluorescence or FRET-based reporter systems. This method allows researchers to mix YidC-containing proteoliposomes with substrate proteins and observe insertion events that occur on millisecond to second timescales. By systematically varying reaction conditions, the rate-limiting steps in YidC-mediated insertion can be identified.

For comprehensive kinetic analysis, researchers should employ global fitting approaches that integrate data from multiple experimental techniques and conditions into unified kinetic models. These models should account for potential parallel insertion pathways, cooperativity effects, and the influence of lipid composition on insertion kinetics.

TechniqueTemporal ResolutionAdvantagesLimitations
Real-time fluorescenceSeconds to minutesNon-invasive, continuous monitoringRequires fluorescent labeling
Single-molecule force spectroscopyMillisecondsSingle-molecule resolution, energy landscape mappingTechnically demanding, low throughput
Stopped-flow kineticsMillisecondsExcellent for rapid eventsLimited to initial insertion steps
Protease protection assaysMinutesSimple setup, clear readoutEnd-point rather than continuous measurement
Site-specific crosslinkingVariableCaptures transient intermediatesLimited temporal resolution

How can recombinant YidC be utilized in developing vaccines against Leptospira interrogans?

Recombinant YidC from Leptospira interrogans represents a promising candidate for vaccine development due to several advantageous characteristics. As an essential membrane protein insertase, YidC plays a critical role in bacterial viability and is likely to be expressed during infection, making it a potential target for protective immune responses. The relatively high conservation of YidC within Leptospira species suggests that vaccines targeting this protein might provide cross-protection against multiple serovars, addressing one of the major challenges in leptospirosis vaccine development .

For effective vaccine formulation, researchers can employ several approaches utilizing recombinant YidC. Subunit vaccines containing purified recombinant YidC or immunogenic epitopes derived from YidC could stimulate specific antibody and T-cell responses. Since full-length membrane proteins like YidC present challenges for expression and purification, focusing on extramembrane domains that are accessible to the immune system represents a practical strategy. The cytoplasmic coiled-coil domain (C1) of YidC, which plays a crucial role in substrate recognition, could serve as a particularly attractive antigenic target .

DNA vaccines encoding YidC or selected epitopes offer another promising approach. These vaccines would allow for endogenous expression of YidC antigens, potentially eliciting both humoral and cell-mediated immune responses. For enhanced efficacy, YidC-based vaccines could be combined with other immunogenic Leptospira antigens in multivalent formulations. Research has demonstrated that combining multiple recombinant antigens can achieve sensitivity close to 90% in diagnostic applications, suggesting a similar approach might be beneficial for vaccines .

Evaluation of YidC-based vaccine candidates should include comprehensive immunogenicity studies in animal models, assessment of protection against challenge with virulent Leptospira strains, and analysis of cross-protection against diverse serovars. Safety profiles must be thoroughly characterized, with particular attention to potential autoimmune responses, given that YidC has homologs in higher organisms.

What are the methodological considerations for developing YidC inhibitors as potential antimicrobial agents?

Developing YidC inhibitors as potential antimicrobial agents against Leptospira interrogans requires careful methodological considerations spanning target validation, screening approaches, and medicinal chemistry optimization. Target validation is the essential first step, confirming that YidC inhibition will result in growth inhibition or killing of Leptospira interrogans under relevant conditions. Conditional expression systems or CRISPR interference approaches can demonstrate the essentiality of YidC in various growth conditions and infection models, establishing its viability as a therapeutic target .

High-throughput screening methodologies need to be specifically designed for membrane protein targets like YidC. Cell-based screens monitoring bacterial growth in the presence of compound libraries can identify hits with cellular activity, while target-based screens using purified recombinant YidC can identify direct inhibitors. For target-based approaches, researchers must develop robust biochemical assays that reflect YidC's insertase activity. This could involve monitoring the insertion of fluorescently labeled substrate peptides into liposomes containing reconstituted YidC, with inhibition resulting in decreased fluorescence signal .

Structural insights into YidC's mechanism of action should guide rational inhibitor design. The hydrophilic groove and greasy slide of YidC represent potential binding sites for small molecules that could disrupt substrate recognition or translocation . Fragment-based drug discovery approaches, utilizing biophysical techniques like surface plasmon resonance or thermal shift assays, can identify chemical starting points for inhibitor development.

Medicinal chemistry optimization must address the significant challenge of targeting a membrane protein within Gram-negative bacteria. Compounds must penetrate the outer membrane barrier while maintaining activity against the membrane-embedded YidC protein. Lipophilicity, molecular weight, and charge characteristics require careful balancing to achieve the desired pharmacokinetic and pharmacodynamic properties.

Resistance potential should be evaluated early in the development process, using serial passage experiments to identify potential resistance mechanisms. Cross-resistance studies with other antimicrobials and combination testing would inform optimal treatment strategies to minimize resistance development.

Selectivity profiling against mammalian homologs of YidC is crucial for developing safe antimicrobials. While evolutionary differences exist between bacterial and eukaryotic insertases, sufficient selectivity must be demonstrated to avoid host toxicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.