Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us for prioritized development.
Synonyms
crcB; LA_3777; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
crcB
Target Protein Sequence
MNFSKSLLLIAFGGTIGSIFRYLLQYWFGNVLGYSLPWGTLTANLLGSFLIGVVYAISDR FPLFDPQWKFLLASGFCGGFTTFSTFSYETFQMLKSGHYILFLGYICLSVVGGIGFAFAG VWMIKNF
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: lil:LA_3777

STRING: 189518.LA_3777

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the CrcB homolog across different Leptospira species and serovars?

While the search results don't specifically address conservation of CrcB across Leptospira strains, comparative genomics approaches could be employed similar to those used for other leptospiral proteins. Researchers should:

  • Perform BLAST analysis against different Leptospira genomes

  • Use multiple sequence alignment tools (CLUSTAL, MUSCLE) to identify conserved regions

  • Calculate percent identity and similarity across pathogenic and saprophytic Leptospira species

  • Evaluate phylogenetic relationships based on CrcB sequences

Unlike LRR proteins that show variable conservation across Leptospira subclades (as seen with LIC11051 and LIC11505), membrane transporters like CrcB might be more highly conserved due to their fundamental physiological functions .

What are the predicted transmembrane domains and topology of the CrcB homolog?

Based on similar membrane proteins in bacteria, CrcB homolog likely contains multiple transmembrane segments. Researchers should use multiple prediction tools to determine the membrane topology:

  • TMHMM, Phobius, or TOPCONS for transmembrane helix prediction

  • PredictProtein or I-TASSER for secondary structure elements

  • SignalP for signal peptide identification (though the available sequence starts at position 1 without a predicted signal peptide)

  • Psipred for secondary structure estimation

The function as a putative fluoride ion transporter suggests a channel-forming structure with a selectivity filter for fluoride ions. The protein's structure likely conforms to the classic topology of bacterial ion channels with transmembrane helices forming a pore .

What is the optimal expression system for producing recombinant CrcB homolog protein?

Based on the available information and parallels with other Leptospira proteins, the recommended expression system is:

Bacterial Expression System:

  • E. coli strain: BL21(DE3) Star pLysS or BL21-SI (salt-inducible) for potentially toxic membrane proteins

  • Expression vector: pAE vector with N-terminal 10xHis-tag or pRSET for N-terminal 6xHis-tag fusion

  • Induction: 0.1 mM IPTG at 18°C for 16 hours (to improve solubility)

  • Growth medium: LB supplemented with appropriate antibiotics

This approach is similar to the successful expression of recombinant LIC11051 and LIC11505 proteins .

How can researchers optimize purification of CrcB homolog to obtain high-quality protein for functional studies?

The purification protocol should address the membrane protein nature of CrcB:

  • Cell Lysis: Resuspend cells in lysis buffer (20 mM Tris-HCl [pH 7.5], 200 mM NaCl, 200 μg/mL lysozyme, 2 mM phenylmethylsulfonyl fluoride [PMSF], and 1% Triton X-100)

  • Sonication: 10 minutes on ice with pulse cycles

  • Centrifugation: 10,000 × g for 10 min at 4°C

  • Ni²⁺ Affinity Chromatography:

    • Apply supernatant to HisTrap HP column

    • Wash with incrementally increasing imidazole concentrations (20 mM, 40 mM, 60 mM)

    • Elute with higher imidazole concentration (250-500 mM)

  • Dialysis: Three steps of 1 hour each in Tris-NaCl buffer to remove imidazole

  • Quality Control: SDS-PAGE and Western blot with anti-His antibody

For membrane proteins that form inclusion bodies, a denaturation/refolding strategy may be necessary, using 8 M urea or 6 M guanidine hydrochloride followed by step-wise dialysis to remove the denaturant .

What are the key challenges in obtaining functional recombinant CrcB homolog protein?

Researchers face several specific challenges when working with Leptospira CrcB homolog:

  • Membrane Protein Solubility: As a putative ion transporter, CrcB is likely a membrane protein with hydrophobic regions that may lead to inclusion body formation

  • Proper Folding: Ensuring native-like folding of the protein in a heterologous expression system

  • Functional Assessment: Validating that the recombinant protein retains fluoride transport capability

  • Post-translational Modifications: Identifying whether any leptospiral-specific modifications are necessary for function

  • Protein Stability: Maintaining stability during purification and downstream applications

Researchers might consider using E. coli ArcticExpress (DE3) for expression at lower temperatures (8-12°C) to improve folding, similar to the successful expression of other leptospiral proteins .

What biophysical techniques are most effective for structural characterization of the CrcB homolog?

To thoroughly characterize the CrcB homolog structure, researchers should employ a multi-technique approach:

Expected results should be compared with predicted structures from homology modeling and ab initio structure prediction methods like I-TASSER or AlphaFold .

How can researchers experimentally validate the fluoride ion transport function of the CrcB homolog?

To validate the putative fluoride transport function, researchers should:

  • Fluoride Efflux Assays:

    • Engineer E. coli strains lacking endogenous CrcB

    • Express L. interrogans CrcB homolog

    • Measure intracellular fluoride levels using fluoride-specific electrodes or fluorescent indicators

  • Proteoliposome Reconstitution:

    • Purify recombinant CrcB homolog

    • Reconstitute into liposomes

    • Measure fluoride uptake using fluoride-sensitive dyes or radioisotopes

  • Patch-Clamp Electrophysiology:

    • Express CrcB in cell lines suitable for electrophysiological recording

    • Measure ion conductance in presence of different concentrations of fluoride

    • Determine ion selectivity by testing conductance with other anions

  • Growth Complementation:

    • Test if L. interrogans CrcB can complement growth defects in F⁻-sensitive E. coli strains lacking endogenous fluoride exporters when grown in fluoride-containing media

These approaches will help determine if the protein functions as a fluoride exporter, protecting the bacterial cell from fluoride toxicity .

What techniques are available for studying CrcB homolog interactions with other proteins or cellular components?

To investigate the protein interaction network of CrcB homolog:

  • Co-Immunoprecipitation (Co-IP):

    • Generate specific antibodies against CrcB homolog

    • Pull down protein complexes from leptospiral lysates

    • Identify binding partners using mass spectrometry

  • Bacterial Two-Hybrid System:

    • Test for specific interactions with candidate proteins

    • Particularly useful for membrane protein interactions

  • Surface Plasmon Resonance (SPR):

    • Measure binding kinetics and affinities between CrcB and potential partners

    • Requires purified recombinant proteins

  • Crosslinking Mass Spectrometry:

    • Use chemical crosslinkers to capture transient interactions

    • Identify interaction sites at amino acid resolution

  • Fluorescence Resonance Energy Transfer (FRET):

    • Create fluorescent fusion proteins to visualize interactions in live cells

    • Similar to the approach used for EGFP-LIC10778 fusion proteins

These methods could reveal whether CrcB interacts with other membrane components or cytoplasmic proteins involved in fluoride sensing or homeostasis.

How can CRISPR/Cas9 technology be applied to create knockout mutants of the crcB gene in L. interrogans?

Based on recent advances in Leptospira mutagenesis, researchers can use the following approach:

  • Design sgRNA targeting crcB:

    • Select 20-nt target sequences in the crcB gene with NGG PAM sites

    • Avoid off-target effects by checking specificity against the Leptospira genome

  • Utilize the improved CRISPR/Cas9-NHEJ system:

    • Use plasmid pMaOriCas9NHEJsmegmatis containing:

      • S. pyogenes Cas9

      • Mycobacterium smegmatis NHEJ components (LigD and Ku)

      • sgRNA cassette targeting crcB

    • This system has proven more effective than M. tuberculosis NHEJ for Leptospira

  • Conjugation and selection:

    • Transfer the plasmid to L. interrogans via conjugation with E. coli β2163

    • Select transformants on media containing spectinomycin

  • Screen for knockout mutants:

    • Use PCR and sequencing to identify indel mutations in crcB

    • Expected deletions range from 10 to 345 bp based on LipL32 knockout results

    • Validate loss of CrcB homolog expression using immunoblotting

  • Plasmid curing:

    • Perform serial passages without antibiotic selection

    • Screen for loss of plasmid by plating on media with/without spectinomycin

    • Confirm permanent knockout via PCR and sequencing

This approach has successfully generated scarless, marker-free knockout mutants in pathogenic Leptospira strains .

What phenotypic assays can be used to characterize crcB knockout mutants?

Researchers should employ multiple phenotypic assays to understand CrcB function:

  • Fluoride sensitivity assays:

    • Compare growth of wild-type and ΔcrcB mutants in media with increasing fluoride concentrations

    • Measure growth curves and determine MIC (minimum inhibitory concentration)

  • Intracellular pH measurements:

    • Use pH-sensitive fluorescent dyes to assess if fluoride accumulation affects cytoplasmic pH

  • Metal ion homeostasis:

    • Measure intracellular levels of various ions (F⁻, Cl⁻, other anions)

    • Determine if CrcB affects other ion transport systems

  • Virulence assessment:

    • Compare wild-type and ΔcrcB strains in hamster or mouse infection models

    • Measure bacterial loads in target organs (kidney, liver)

    • Assess histopathological changes

  • Transcriptome analysis:

    • Perform RNA-seq to identify compensatory changes in gene expression

    • Focus on other ion transporters or stress response genes

  • Membrane integrity tests:

    • Assess sensitivity to membrane-disrupting agents

    • Evaluate membrane potential using fluorescent probes

These assays will help determine if CrcB is essential for leptospiral survival, particularly under fluoride stress conditions or during host infection .

What transcriptomic approaches would be useful to understand the regulation of crcB expression in different environmental conditions?

To investigate crcB expression regulation:

  • RNA-seq analysis:

    • Compare transcriptome profiles under various conditions:

      • Different fluoride concentrations

      • Various pH values

      • Osmotic stress conditions

      • Host-mimicking environments (serum, macrophage co-culture)

    • Identify co-regulated genes that may form functional units with crcB

  • Quantitative RT-PCR:

    • Validate RNA-seq findings with targeted gene expression analysis

    • Use reference genes like 16S rRNA, flaB, or lipL41 for normalization

  • Promoter analysis:

    • Identify the promoter region of crcB

    • Construct reporter gene fusions (e.g., lacZ or gfp) to monitor promoter activity

    • Determine transcription start sites using 5'RACE

  • Transcription factor binding studies:

    • Use ChIP-seq to identify proteins that bind to the crcB promoter

    • Perform electrophoretic mobility shift assays (EMSA) with purified candidate regulators

  • Microarray hybridization:

    • An alternative to RNA-seq that has been successfully used for Leptospira

    • Can detect genes expressed above median level, as described for vaccine candidate identification

These approaches would reveal whether crcB expression is constitutive or regulated in response to specific environmental signals, providing insights into its physiological role .

How can researchers evaluate the immunogenicity of recombinant CrcB homolog protein?

To assess the immunogenic potential of recombinant CrcB homolog:

  • Animal immunization studies:

    • Immunize hamsters or mice with purified recombinant CrcB (50 μg per dose)

    • Use alum as adjuvant, with subcutaneous administration at 3 and 6 weeks

    • Collect sera at days 0, 21, 42, and post-challenge (day 71)

    • Measure antibody responses using KELA (kinetic ELISA) as done for other Leptospira antigens

  • Antibody titer determination:

    • Optimize antigen concentrations through checkerboard titration

    • Coat ELISA plates with recombinant CrcB at optimal concentration

    • Perform serial dilutions of sera to determine endpoint titers

    • Differentiate between IgM and IgG responses

  • Cross-reactivity assessment:

    • Test antibodies against whole-cell lysates from different Leptospira serovars

    • Evaluate cross-reactivity with CrcB homologs from other bacterial species

  • Epitope mapping:

    • Generate truncated fragments of CrcB to identify immunodominant regions

    • Use peptide arrays to identify linear epitopes recognized by antibodies

This approach parallels successful immunogenicity testing of other leptospiral recombinant proteins like LigA, Lsa14, and rLIC11711 .

What experimental design would determine if CrcB homolog could be a viable vaccine candidate against leptospirosis?

A comprehensive vaccine efficacy assessment would include:

  • Immunization protocol:

    • Group 1: Recombinant CrcB with adjuvant

    • Group 2: GST-tag only with adjuvant (control)

    • Group 3: PBS with adjuvant (control)

    • Two doses (50 μg each) at 3-week intervals

  • Challenge model:

    • Challenge with 10⁸ virulent L. interrogans serovar Lai (approximately LD₅₀)

    • Monitor animals for 21 days post-challenge

    • Record survival rates, clinical signs, and weight changes

  • Protective immunity assessment:

    • Evaluate survival rates

    • Perform histopathological examination of kidneys, liver, and lungs

    • Quantify bacterial burden in tissues using culture and qPCR

    • Assess sterilizing immunity by testing for renal colonization

  • Immunological parameters:

    • Measure antibody titers (IgG and IgM)

    • Assess cellular immune responses (T-cell proliferation, cytokine profiles)

    • Evaluate complement activation and opsonization capacity

  • Cross-protection studies:

    • Challenge with heterologous Leptospira serovars to assess broad protection

This design parallels successful vaccine studies with LigA, which provided 100% protection against lethal challenge with L. interrogans serovar Pomona .

How can researchers determine if antibodies against CrcB homolog provide passive protection against leptospirosis?

To assess passive protection potential:

  • Polyclonal antibody preparation:

    • Immunize rabbits with recombinant CrcB homolog

    • Collect hyperimmune sera

    • Determine antibody titers using KELA

  • Passive immunization protocol:

    • Inject hamsters intraperitoneally with various volumes of anti-CrcB antiserum (50, 100, 200, and 300 μl)

    • Include control groups receiving preimmune serum

    • Challenge with 10⁸ virulent leptospires 1 hour after antibody transfer

  • Protection assessment:

    • Monitor survival rates for 21 days

    • Perform histopathological examination of organs

    • Quantify bacterial loads in tissues

  • Mechanistic studies:

    • Evaluate antibody-dependent complement activation

    • Assess opsonophagocytic activity

    • Determine if antibodies neutralize any functional aspects of CrcB

This approach mirrors passive protection assays performed with anti-LigA antibodies, which determined whether the immune response alone (without cellular immunity) could protect against leptospiral infection .

How might CrcB homolog contribute to fluoride resistance and environmental persistence of L. interrogans?

This complex question requires integrating several research approaches:

  • Environmental persistence studies:

    • Compare survival of wild-type and ΔcrcB mutants in water and soil samples with various fluoride concentrations

    • Evaluate biofilm formation capability in fluoride-containing environments

    • Assess competition between wild-type and mutant strains in mixed cultures

  • Fluoride uptake kinetics:

    • Measure fluoride influx/efflux rates in intact leptospiral cells

    • Determine Km and Vmax values for fluoride transport

    • Compare transport activity at different pH values (fluoride transport can be coupled to H⁺ gradient)

  • Metabolic impact analysis:

    • Fluoride inhibits enolase and other metabolic enzymes

    • Compare central carbon metabolism in wild-type and ΔcrcB strains using metabolomics

    • Measure activities of fluoride-sensitive enzymes

  • Evolution experiments:

    • Subject Leptospira to long-term growth in increasing fluoride concentrations

    • Sequence evolved strains to identify adaptive mutations in crcB or related genes

Understanding fluoride resistance mechanisms might explain how Leptospira survives in certain environmental niches and transitions between environment and host .

What is the significance of CrcB homolog in the context of comparative genomics across Leptospira pathogenicity groups?

To place CrcB in the broader context of Leptospira evolution:

  • Pan-genome analysis:

    • Compare crcB presence, sequence conservation, and genomic context across:

      • Pathogenic species (L. interrogans, L. borgpetersenii)

      • Intermediate pathogens (L. licerasiae)

      • Saprophytic species (L. biflexa)

    • Determine if crcB is part of the core or accessory genome

  • Synteny analysis:

    • Examine conservation of gene order surrounding crcB

    • Identify whether crcB is part of any genomic islands or mobile genetic elements

    • Assess if crcB is located near the rfb locus or other recombination hotspots identified in Leptospira

  • Selection pressure analysis:

    • Calculate dN/dS ratios to determine if crcB is under purifying or diversifying selection

    • Identify specific amino acid residues under selection

  • Transcriptome comparison:

    • Compare crcB expression levels across different Leptospira species

    • Determine if expression correlates with pathogenicity potential

How might structural and functional insights from CrcB homolog research contribute to novel antimicrobial development against Leptospira?

This forward-looking question explores therapeutic applications:

  • Structure-based drug design:

    • Use high-resolution structures of CrcB to identify potential binding pockets

    • Perform virtual screening of compound libraries to identify potential inhibitors

    • Design small molecules that could block the fluoride transport channel

  • Functional inhibition assays:

    • Develop high-throughput screening methods to identify compounds that inhibit CrcB function

    • Test candidates in fluoride efflux assays using proteoliposomes or whole cells

  • Antimicrobial efficacy testing:

    • Evaluate if CrcB inhibitors enhance fluoride toxicity in Leptospira

    • Test combinations with existing antibiotics for synergistic effects

    • Assess spectrum of activity against different Leptospira species and other bacteria

  • Resistance development assessment:

    • Determine frequency of resistance emergence

    • Identify resistance mechanisms through whole-genome sequencing of resistant mutants

  • Host toxicity evaluation:

    • Assess potential for cross-reactivity with mammalian fluoride transporters

    • Evaluate cytotoxicity in human cell lines

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.