Recombinant Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai UPF0316 protein LA_0606 (LA_0606)

Shipped with Ice Packs
In Stock

Description

General Information

LA_0606 is a protein from Leptospira interrogans serovar Lai, categorized under UPF0316 proteins, which are proteins of unknown function . The precise function of LA_0606 is not yet fully understood, but research suggests potential roles in bacterial pathogenesis, including host invasion, dissemination, and immune evasion processes .

Structure and Properties

While specific structural details for LA_0606 are not widely available, some research has explored similar Leptospira proteins. For example, LIC13086, a related protein, has been analyzed using SDS-PAGE, CD Spectroscopy, and serum reactivity assays .

Research Findings

Research on similar Leptospira proteins provides insight into potential functions of LA_0606. Studies indicate that these proteins can interact with:

  • Extracellular matrix components: Such as laminin, which aids in adhesion and dissemination .

  • Plasma components: Including plasminogen, fibrinogen, and plasma fibronectin, suggesting roles in adhesion and inhibiting blood clot formation .

  • Complement system regulators: Like C4BP, indicating involvement in immune evasion .

One study showed that the recombinant protein LIC13086 could bind to plasminogen, plasma fibronectin, fibrinogen, and C4BP . Plasma fibronectin and C4BP bindings to rLIC13086 were dose-dependent, with K D of 5.8 ± 0.4 nM and 8.9 ± 0.8 nM, respectively . Also, rLIC13086 was capable of significantly inhibiting the fibrin clot formation when compared with the positive control containing only fibrinogen and thrombin .

Role in Pathogenesis

Given the interactions of related proteins, LA_0606 may play a role in leptospiral pathogenesis. This includes potential involvement in host invasion, dissemination, and immune evasion processes .

Tables

ProteinInteraction with Host ComponentsPotential Role in Pathogenesis
LA_0606 (Inferred)Laminin, PlasminogenAdhesion, Dissemination, Fibrin clot inhibition, Immune evasion

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
LA_0606; UPF0316 protein LA_0606
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Target Names
LA_0606
Target Protein Sequence
MEFSFPLPGNPIFDYVLLPCFIFLSRVTDVSIGTIRVILLTREKKGIAASLGFLEVLLWV VVITQVIKNLNNVFCYLAYAGGFATGTFIGMILEEKLAIGFSLLRIISPQNGSEIADKLS EAGYRVTIMNGHGSRGPVKIVFTVLKRKKIDQAMKIVQNVEPDVFYSIENARRTNTTTFE DSPGLLRRGILEKILKIRK
Uniprot No.

Target Background

Database Links

KEGG: lil:LA_0606

Protein Families
UPF0316 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of LA_0606 in Leptospira interrogans?

LA_0606 is a protein-coding gene found in the genome of Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai. The protein belongs to the UPF0316 family, whose function has not been fully characterized. Based on genomic analyses similar to those conducted for other Leptospira proteins, LA_0606 was likely identified during genome sequencing projects of L. interrogans serovars . The gene's location in the genome may provide insights into potential operons or gene clusters that could suggest functional relationships with neighboring genes.

How is recombinant LA_0606 typically expressed and purified for research purposes?

Recombinant LA_0606 protein is typically expressed using similar methodologies to those employed for other Leptospira proteins. Based on protocols used for similar proteins:

  • The LA_0606 gene is amplified by PCR from genomic DNA of L. interrogans

  • The amplified gene is cloned into an expression vector (commonly pET-based vectors)

  • Expression is performed in E. coli hosts such as BL21(DE3)

  • Induction is typically achieved using IPTG at concentrations of 0.1-1.0 mM

  • Proteins are purified using affinity chromatography (His-tag purification)

  • Further purification may involve ion-exchange or gel filtration chromatography

  • Protein concentration is determined using methods such as Bradford assay or BCA assay

The protocol would need to be optimized specific to LA_0606's characteristics, particularly if solubility issues are encountered, which is common with recombinant leptospiral proteins .

What are the predicted structural characteristics of LA_0606?

While specific structural data for LA_0606 is not provided in the search results, predictions can be made based on bioinformatic approaches and comparative analysis with other UPF0316 family proteins:

Structural FeaturePrediction MethodPredicted Characteristic
Secondary structurePSIPREDLikely contains alpha-helical regions and beta-sheets
DomainsInterPro/PfamUPF0316 domain
Transmembrane regionsTMHMMRequires specific analysis
Signal peptideSignalPRequires specific analysis
Post-translational modificationsNetPhos/NetOGlycPotential phosphorylation and glycosylation sites
Molecular weightProtParamBased on amino acid sequence

Experimental verification through techniques such as circular dichroism or X-ray crystallography would be necessary to confirm these predictions.

How can native LA_0606 expression be detected in different Leptospira strains?

Native LA_0606 expression can be detected using methodologies similar to those employed for other Leptospira proteins:

  • Western blotting: Using polyclonal antibodies raised against recombinant LA_0606 to probe whole-cell lysates of different Leptospira strains. This approach allows detection of the native protein and comparison between pathogenic and non-pathogenic strains, as demonstrated for LIC11051 and LIC11505 .

  • RT-PCR: Assessing transcriptional levels of LA_0606 in various strains and under different growth conditions.

  • Proteomics approach: Mass spectrometry analysis of leptospiral protein fractions to detect and quantify LA_0606 expression.

When detecting native proteins in Leptospira, it's important to include proper controls and consider cross-reactivity with similar proteins, as observed with LRR-proteins where polyclonal antibodies cross-react with other proteins containing similar domains .

What factors influence the expression of LA_0606 during leptospiral infection?

While specific data for LA_0606 is not available in the search results, expression regulation can be investigated through:

  • Temperature shifts (37°C versus environmental temperatures)

  • Osmolarity changes (representing transition from environment to host)

  • Different sera or physiological conditions

  • Iron limitation

  • Oxidative stress

Research using qRT-PCR and western blotting under these various conditions would help elucidate the expression patterns of LA_0606 during infection. Similar proteins have shown differential expression during infection processes, suggesting that LA_0606 may also be regulated in response to environmental cues experienced during host infection .

What is the cellular localization of LA_0606 in Leptospira interrogans?

Determining cellular localization of LA_0606 would require experimental approaches similar to those used for other leptospiral proteins:

  • Subcellular fractionation: Separating outer membrane, inner membrane, periplasmic, and cytoplasmic fractions followed by western blotting with anti-LA_0606 antibodies.

  • Immunogold electron microscopy: Using gold-labeled antibodies to visualize the location of LA_0606 in intact bacteria.

  • Protease accessibility assays: Treating intact cells with proteases that cannot penetrate the outer membrane, followed by detection of remaining LA_0606 by western blotting.

  • Secretion analysis: Examining culture supernatants for presence of LA_0606, as some leptospiral proteins are secreted and may reassociate with the bacterial surface, as shown for LIC11051 and LIC11505 .

These approaches would help determine whether LA_0606 is cytoplasmic, membrane-associated, or secreted, which would provide insights into its potential function.

What protein-protein interactions has LA_0606 been shown to participate in?

Protein-protein interactions for LA_0606 can be investigated using:

  • Yeast two-hybrid screening: This approach identifies potential protein partners from leptospiral or host protein libraries.

  • Co-immunoprecipitation: Using antibodies against LA_0606 to pull down protein complexes from leptospiral lysates.

  • Pull-down assays: Immobilizing recombinant LA_0606 and incubating with leptospiral or host cell lysates.

  • Surface plasmon resonance: Measuring direct binding between LA_0606 and candidate interaction partners.

For leptospiral proteins, interactions with host components are particularly relevant. Some proteins, such as LIC11505, have shown interactions with host extracellular matrix components and cell surface receptors, which could provide a model for investigating LA_0606's potential interactions .

What is the potential role of LA_0606 in Leptospira pathogenesis?

The role of LA_0606 in pathogenesis could be investigated through several approaches:

  • Gene knockout/knockdown: Creating LA_0606 mutants and assessing virulence in animal models.

  • Binding assays with host components: Testing recombinant LA_0606 for binding to extracellular matrix proteins, plasma proteins, and cell surface receptors, similar to investigations of LIC11051 and LIC11505 .

  • Inhibition studies: Using anti-LA_0606 antibodies or recombinant protein to block leptospiral adhesion to host cells.

  • Comparative genomics: Analyzing the presence and conservation of LA_0606 across pathogenic and non-pathogenic Leptospira species.

  • Transcriptional analysis: Examining expression changes during infection using RNA-seq or qRT-PCR.

If LA_0606 follows patterns observed with other leptospiral proteins, it might contribute to adhesion, immune evasion, or other virulence mechanisms .

Does LA_0606 interact with host extracellular matrix components?

Interaction with extracellular matrix (ECM) components can be assessed using established binding assays:

  • ELISA-based binding assays: Immobilizing ECM components (collagen, laminin, fibronectin, elastin) and testing binding of recombinant LA_0606.

  • Surface plasmon resonance: Measuring binding kinetics between LA_0606 and ECM components.

  • Inhibition of bacterial adhesion: Testing whether recombinant LA_0606 or anti-LA_0606 antibodies can inhibit leptospiral adhesion to ECM-coated surfaces.

ECM ComponentBinding AssayExpected Outcome
Collagen IELISA±
Collagen IVELISA±
LamininELISA±
FibronectinELISA±
ElastinELISA±

Similar leptospiral proteins such as LIC11505 have demonstrated binding to multiple ECM components, supporting the importance of testing LA_0606 for such interactions .

How can structural analysis of LA_0606 inform vaccine development strategies?

Structural analysis of LA_0606 would involve:

  • X-ray crystallography: Determining the three-dimensional structure at atomic resolution.

  • NMR spectroscopy: Analyzing structure in solution and potential dynamic regions.

  • Cryo-electron microscopy: Visualizing larger complexes involving LA_0606.

  • Epitope mapping: Identifying immunogenic regions through peptide arrays or hydrogen-deuterium exchange.

The resulting structural data could guide vaccine development by:

  • Identifying surface-exposed regions suitable as vaccine antigens

  • Detecting conserved epitopes across different Leptospira serovars

  • Understanding structural changes relevant to antibody recognition

  • Guiding rational design of stable immunogens

If LA_0606 shows immunogenic properties in sera from leptospirosis patients, similar to observations with LIC11051 and LIC11505 , it could be a candidate for inclusion in subunit vaccines.

What methodological approaches can resolve contradictory findings about LA_0606 function?

When contradictory findings about protein function arise, several methodological approaches can help resolve discrepancies:

  • Standardization of experimental conditions: Ensuring consistent bacterial strains, growth conditions, and assay parameters across studies.

  • Multi-laboratory validation: Having independent laboratories reproduce key findings using standardized protocols.

  • Complementary techniques: Employing multiple methodologies to investigate the same question from different angles.

  • Genetic approaches: Creating knockout mutants and complemented strains to definitively link phenotypes to LA_0606.

  • Domain-specific analysis: Testing individual domains or fragments of LA_0606 to understand which regions are responsible for specific activities.

  • Temporal and environmental factors: Investigating whether LA_0606 function varies under different conditions or growth phases.

The clear and focused approach to scientific questions, as outlined in search result , emphasizes the importance of developing appropriate research questions to resolve contradictions.

How can time-resolved techniques be applied to study LA_0606 dynamics during infection?

Time-resolved techniques can provide insights into the dynamics of LA_0606 during infection:

  • Time-resolved infrared spectroscopy: As described in search result , this technique can be adapted to study conformational changes in LA_0606 under conditions mimicking the host environment.

  • Live cell imaging: Using fluorescently tagged LA_0606 to track its localization during infection processes.

  • Temporal transcriptomics and proteomics: Analyzing expression patterns at different time points during infection.

  • Real-time binding assays: Measuring association and dissociation kinetics with host components.

  • Time-resolved electron diffraction: As mentioned in search result , this technique could be adapted to study structural changes in LA_0606 in response to environmental triggers.

The experimental procedure would include:

  • Preparing samples at different time points during infection

  • Applying appropriate biophysical techniques

  • Analyzing temporal data to identify significant changes

  • Correlating structural/functional changes with infection stages

How can cross-reactivity of anti-LA_0606 antibodies with other leptospiral proteins be assessed and managed?

Cross-reactivity is a common challenge with antibodies against leptospiral proteins, as demonstrated with LRR-proteins where polyclonal antibodies recognized multiple proteins with similar domains . To assess and manage this:

  • Western blotting against multiple leptospiral proteins: Testing anti-LA_0606 antibodies against whole cell lysates from different Leptospira species and recombinant proteins.

  • Epitope mapping: Identifying specific regions recognized by antibodies.

  • Absorption studies: Pre-absorbing antibodies with recombinant proteins to remove cross-reactive antibodies.

  • Monoclonal antibody development: Creating monoclonal antibodies targeting unique epitopes of LA_0606.

  • Validation with knockout strains: Using LA_0606 deletion mutants as negative controls.

  • Peptide-specific antibodies: Generating antibodies against unique peptide sequences within LA_0606.

Example experimental approach based on search result :

  • Generate polyclonal antibodies against recombinant LA_0606

  • Test reactivity against whole-cell lysates of pathogenic and saprophytic Leptospira

  • Include recombinant proteins with similar domains as controls

  • Perform ELISA to quantify cross-reactivity

What is the serological response to LA_0606 during natural infection with Leptospira interrogans?

Investigating serological responses would involve:

  • ELISA with patient sera: Testing sera from confirmed leptospirosis patients at different stages of infection for reactivity with recombinant LA_0606.

  • Western blotting: Confirming specificity of antibody responses.

  • IgM versus IgG responses: Characterizing the class of antibodies produced and their temporal dynamics.

  • Comparative analysis: Evaluating responses to LA_0606 compared to other leptospiral antigens.

  • Animal models: Analyzing antibody responses in experimental infections.

Similar studies with LIC11051 and LIC11505 showed that these proteins were recognized by antibodies in leptospirosis serum samples, suggesting expression during infection . If LA_0606 follows a similar pattern, it could indicate its expression during infection and potential immunogenicity.

How does the cellular immune response target LA_0606 during leptospiral infection?

Cellular immune responses can be investigated through:

  • T-cell proliferation assays: Stimulating peripheral blood mononuclear cells from leptospirosis patients with recombinant LA_0606.

  • Cytokine profiling: Measuring cytokine production (IFN-γ, IL-4, IL-17, etc.) in response to LA_0606 stimulation.

  • Flow cytometry: Analyzing T-cell subsets (CD4+, CD8+) activated by LA_0606.

  • Epitope prediction and validation: Using bioinformatics to predict T-cell epitopes followed by experimental validation.

  • Animal models: Examining cellular responses in experimental leptospirosis.

Understanding cellular immune responses is crucial for vaccine development and may provide insights into protective immunity against leptospirosis.

What are the common pitfalls in expressing and purifying recombinant LA_0606, and how can they be overcome?

Common challenges in recombinant protein expression and purification include:

ChallengeSolution
InsolubilityUse solubility-enhancing tags (MBP, SUMO); modify buffer conditions; employ refolding protocols
Low expressionOptimize codon usage; test different expression hosts; vary induction conditions
DegradationInclude protease inhibitors; reduce expression temperature; purify rapidly
Improper foldingCo-express chaperones; use slower induction; optimize refolding
Toxicity to hostUse tightly regulated expression systems; express toxic domains separately
AggregationAdd detergents or stabilizing agents; optimize storage conditions

For leptospiral proteins specifically, challenges may include:

  • Different codon usage patterns requiring optimization

  • Post-translational modifications not replicated in E. coli

  • Difficulty in replicating native conformations

Successful expression strategies would need to be tailored to LA_0606's specific characteristics, possibly following approaches used for other challenging leptospiral proteins .

How can the biological activity of recombinant LA_0606 be verified to ensure it matches the native protein?

Verifying biological activity requires several complementary approaches:

  • Structural analysis: Comparing secondary and tertiary structure of recombinant and native proteins using circular dichroism or other spectroscopic methods.

  • Functional assays: Testing recombinant LA_0606 in relevant biological assays, such as binding to potential ligands or receptors.

  • Competition assays: Determining whether recombinant protein can compete with native protein for binding or function.

  • Antibody recognition: Confirming that antibodies against recombinant protein recognize native protein and vice versa.

  • Complementation studies: Testing whether recombinant LA_0606 can restore function in knockout strains.

  • Post-translational modifications: Analyzing whether critical modifications present in native protein are also present in recombinant versions.

As observed with LIC11051 and LIC11505, recombinant proteins that retain native binding properties can provide valuable insights into protein function .

What advanced microscopy techniques are most suitable for studying LA_0606 localization and dynamics?

Advanced microscopy techniques suitable for studying LA_0606 include:

  • Super-resolution microscopy (STORM, PALM, STED): Overcoming the diffraction limit to visualize protein localization at nanometer resolution.

  • Immunogold electron microscopy: Precisely localizing LA_0606 in cellular ultrastructure.

  • Live-cell imaging: Using fluorescently-tagged LA_0606 to track dynamics in real-time.

  • FRET microscopy: Investigating protein-protein interactions by measuring energy transfer between fluorophores.

  • Single-molecule tracking: Following individual LA_0606 molecules to understand mobility and interactions.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence and electron microscopy data.

Implementation would require:

  • Generating specific antibodies or fluorescent protein fusions

  • Optimizing sample preparation for each technique

  • Developing appropriate controls

  • Using image analysis software for quantification

  • Correlating localization data with functional studies

These techniques could reveal the distribution of LA_0606 during different stages of infection and under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.