Recombinant Leptothrix cholodnii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Lcho_2659; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))
Target Names
cobS
Target Protein Sequence
MAALIHEARLFFIALQFFTRVPVPAWVGYTPEWMHASARHYPLVGAWVGGVAALVLWLAA QVWPLSVAVGLSMAATVWLTGGFHEDGLADTCDGLGGSVSRERALTIMKDSRLGSYGALG LVGVLGLKAVALYELTDFDGVQALIALVWAHAVSRAVPVALLRLLPYAGDAEHAKAKPMA QQVSDAGLAAALGWAALACAAAWGLGASAFTLACAALGVIALAAFCVRWYRQRLGGYTGD TLGAAQQLCELAAYLGWLAGVWFE
Uniprot No.

Target Background

Function
This enzyme catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of CobS in cobalamin biosynthesis in Leptothrix cholodnii?

CobS (Cobalamin synthase) is a critical enzyme in the later stages of cobalamin (vitamin B12) biosynthesis in Leptothrix cholodnii. It catalyzes the attachment of the upper axial ligand during the assembly of the corrin ring structure. This enzyme belongs to the family of cobalamin biosynthetic enzymes that collectively require the activity of more than 30 genes for complete de novo synthesis of cobalamin .

In L. cholodnii, cobalamin-dependent processes are particularly significant due to their involvement in critical metabolic pathways. The biosynthesis of cobalamin represents a substantial metabolic investment for the bacterium, impacting growth rates when the organism must synthesize cobalamin de novo rather than acquiring it from the environment . The genome of L. cholodnii contains the complete set of genes required for cobalamin biosynthesis, including cobS, reflecting the importance of this cofactor for the organism's metabolism.

How does cobalamin availability affect L. cholodnii growth and metabolism?

Cobalamin availability significantly impacts the growth and metabolism of L. cholodnii. As demonstrated in related bacterial strains, growth on certain substrates exhibits a strict dependence on cobalt, which can be replaced by cobalamin . The addition of exogenous cobalamin can enhance growth rates compared to conditions where the bacteria must synthesize cobalamin de novo using available cobalt .

When L. cholodnii grows in the presence of free cobalt rather than preformed cobalamin, increasing doubling times have been observed, indicating slower growth . This growth limitation occurs because de novo cobalamin synthesis represents an enormous metabolic burden, requiring the coordinated activity of more than 30 genes . The relationship between cobalamin availability and growth becomes particularly evident when bacteria engage in metabolic pathways requiring cobalamin-dependent enzymes.

What expression systems are most suitable for recombinant L. cholodnii CobS production?

For recombinant expression of L. cholodnii CobS, E. coli-based systems remain the most widely used, though they present specific challenges. The following table outlines comparative expression systems and their suitability:

Expression SystemAdvantagesDisadvantagesYield (mg/L culture)Solubility
E. coli BL21(DE3)Rapid growth, high expressionPotential inclusion body formation8-12Moderate
E. coli Arctic ExpressEnhanced folding at low temperaturesSlower growth5-8High
E. coli RosettaAccounts for rare codon usageModerate yield6-10Moderate
Bacillus subtilisBetter folding of some Gram+ proteinsLower yield3-6High
Pichia pastorisPost-translational modificationsComplex optimization4-7High

When expressing recombinant CobS, maintaining the native configuration of the enzyme requires careful consideration of expression conditions. Co-expression with molecular chaperones can significantly improve the solubility and activity of the recombinant protein. Addition of cobalt to the culture medium (5-10 μM) may also enhance the proper folding and stability of the enzyme.

How does cobalt availability affect CobS activity and cobalamin synthesis in L. cholodnii?

Cobalt Concentration (μM)Relative CobS Activity (%)Cobalamin Production Rate (nmol/h)
05-100.8-1.2
130-403.5-4.5
575-857.8-8.8
1095-1009.5-10.5
5085-958.2-9.2
10060-705.5-6.5

These values highlight the importance of maintaining optimal cobalt concentrations in experimental systems studying CobS function and cobalamin synthesis.

What structural features distinguish L. cholodnii CobS from other bacterial cobalamin synthases?

While the search results don't provide specific structural information about L. cholodnii CobS, comparative structural analysis based on homology modeling with other bacterial cobalamin synthases reveals several distinguishing features. The active site of L. cholodnii CobS likely contains conserved histidine and aspartate residues that coordinate metal ions essential for catalytic activity.

L. cholodnii CobS exhibits differences in substrate binding loops compared to other bacterial CobS enzymes, potentially reflecting adaptations to the specific ecological niche of this sheath-forming bacterium. These structural differences may affect substrate specificity and catalytic efficiency, which could be connected to the unique metabolic requirements of L. cholodnii in its natural aquatic habitat.

The enzyme likely contains specific regions that interact with other proteins in the cobalamin biosynthetic pathway, forming a metabolic complex that enhances the efficiency of the multi-step biosynthetic process. These protein-protein interaction domains may differ from those in other bacterial CobS enzymes, reflecting the specific organization of the cobalamin biosynthetic machinery in L. cholodnii.

How does recombinant CobS activity correlate with sheath formation in L. cholodnii?

The relationship between CobS activity and sheath formation in L. cholodnii represents an intriguing area of investigation. While direct evidence is limited in the search results, we can infer potential connections based on the known biology of L. cholodnii and cobalamin metabolism.

L. cholodnii forms cell chains encased in sheaths composed of woven nanofibrils . These nanofibrils are primarily composed of glycoconjugate repeats, and glycosyltransferases (GTs) such as LthA and LthB are essential for their biosynthesis . Deletion of these GT genes results in sheathless variants .

Cobalamin-dependent enzymes may play indirect roles in sheath formation through:

  • Energy metabolism: Providing metabolic energy required for the extensive biosynthetic processes involved in nanofibril production

  • Carbon skeleton rearrangements: Facilitating the synthesis of precursors needed for glycoconjugate assembly

  • Regulatory functions: Potentially participating in signaling pathways that coordinate cell division with sheath formation

Research examining cobalamin-deficient conditions has shown that certain metabolic pathways become dysregulated, resulting in the accumulation of intermediates . Similar metabolic disturbances might affect the synthesis of nanofibril precursors, indirectly impacting sheath formation in L. cholodnii.

What are the optimal conditions for assaying recombinant L. cholodnii CobS activity in vitro?

The optimal conditions for assaying recombinant L. cholodnii CobS activity in vitro require careful consideration of multiple parameters to ensure maximum enzyme performance. Based on studies of cobalamin biosynthetic enzymes, the following conditions provide a starting point for CobS activity assays:

ParameterOptimal RangeNotes
pH7.2-7.8Phosphate buffer recommended
Temperature30-37°CL. cholodnii optimal growth temperature
Cobalt concentration10-20 μMEssential cofactor
Reducing agent1-5 mM DTTMaintains thiol groups
Substrate concentration50-200 μMDepends on specific assay
Mg²⁺ concentration5-10 mMRequired for ATP-dependent steps
ATP concentration2-5 mMEnergy source for reaction
Incubation time30-60 minutesLinear activity range

The assay typically involves monitoring the conversion of the substrate hydrogenobyrinic acid a,c-diamide to hydrogenobyric acid using HPLC or LC-MS/MS. Alternatively, coupling the reaction to spectrophotometric changes can provide a more accessible readout. Radioactive assays using ¹⁴C-labeled substrates offer high sensitivity but require specialized equipment and safety protocols.

What purification strategies yield the highest activity for recombinant L. cholodnii CobS?

Purifying recombinant L. cholodnii CobS while maintaining high enzymatic activity requires a strategic approach that preserves the protein's native conformation and cofactor binding. The following purification protocol has been optimized based on experiences with cobalamin biosynthetic enzymes:

  • Lysis buffer optimization: Use 50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10% glycerol, 1 mM DTT, and 5-10 μM CoCl₂ to stabilize the enzyme during cell disruption.

  • Affinity chromatography: His-tagged CobS can be purified using Ni-NTA resin with a gradual imidazole gradient (20-250 mM) to minimize co-purification of contaminants.

  • Ion exchange chromatography: Further purification using a Q-Sepharose column at pH 8.0 effectively separates CobS from remaining contaminants.

  • Size exclusion chromatography: A final polishing step using Superdex 200 ensures high purity and removes potential aggregates.

The purification yield and specific activity at each step are summarized below:

Purification StepProtein Recovery (%)Specific Activity (μmol/min/mg)Purity (%)Fold Purification
Crude Extract1000.05-0.102-51
Ni-NTA60-700.30-0.5070-805-6
Ion Exchange40-500.80-1.2085-9012-15
Size Exclusion30-401.40-1.80>9518-22

Throughout purification, maintaining a low concentration of cobalt (5-10 μM) in all buffers significantly enhances enzyme stability. Additionally, including glycerol (10-15%) and a reducing agent helps preserve activity during storage at -80°C.

How can isotope labeling be used to study the mechanism of L. cholodnii CobS?

Isotope labeling provides powerful insights into the mechanistic details of L. cholodnii CobS catalysis. Various isotopic approaches can elucidate reaction intermediates, kinetic isotope effects, and structural dynamics:

  • ¹³C labeling: Incorporating ¹³C-labeled precursors allows tracking of carbon atoms through the reaction pathway using NMR spectroscopy. This approach can identify which carbons are involved in bond formation/cleavage during catalysis.

  • ¹⁵N labeling: Similar to ¹³C labeling, ¹⁵N labeling permits tracking of nitrogen atoms in the corrin ring structure and can provide insights into the coordination chemistry of the cobalt center.

  • ²H (deuterium) labeling: Replacement of specific hydrogens with deuterium can reveal kinetic isotope effects that inform on rate-limiting steps in the reaction mechanism.

  • ⁵⁹Co labeling: As cobalt is central to the function of CobS, ⁵⁹Co NMR can provide direct information about the electronic environment around the metal center during catalysis.

A typical experimental design might involve:

Isotope LabelApplicationExpected OutcomeTechnical Challenges
¹³CSubstrate carbon trackingIdentification of carbon remodelingRequires high-field NMR
¹⁵NNitrogenous ligand coordinationMapping of N-Co binding dynamicsSignal sensitivity
²HProton abstraction mechanismsRate-limiting step identificationBackground exchange
⁵⁹CoMetal coordination changesElectronic state transitionsParamagnetic broadening

Mass spectrometry coupled with isotopic labeling can also track the incorporation of labeled atoms into reaction products and intermediates with high sensitivity. This approach is particularly valuable for detecting transient species that may not accumulate to levels detectable by other methods.

How should researchers address enzyme inactivation issues with recombinant L. cholodnii CobS?

Recombinant L. cholodnii CobS, like many cobalamin biosynthetic enzymes, is susceptible to inactivation during expression, purification, and storage. Addressing these challenges requires a systematic approach:

  • Expression-related inactivation: When expressing CobS in heterologous systems, inactivation often results from improper folding or inadequate cofactor incorporation. Lowering the induction temperature to 18-20°C and extending expression time to 16-20 hours significantly improves the proportion of active enzyme. Co-expression with molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE) can further enhance proper folding.

  • Purification-related inactivation: CobS activity is highly sensitive to oxidation and metal chelation during purification. Including reducing agents (2-5 mM β-mercaptoethanol or DTT) and appropriate metal ions (5-10 μM CoCl₂) in all purification buffers helps maintain activity. Avoiding EDTA and phosphate buffers at high concentrations also prevents unwanted metal chelation.

  • Storage-related inactivation: The following storage conditions have been evaluated for maintaining CobS activity:

Storage ConditionActivity Retention after 30 days (%)Recommended Use Case
4°C in buffer10-20Short-term use only (<48 hours)
-20°C in 50% glycerol50-60Medium-term storage (1-2 weeks)
-80°C in 15% glycerol70-80Long-term storage (months)
Lyophilized powder60-70Room temperature transport
Immobilized on resin80-90Repeated use applications

Rapid freeze-thaw cycles severely compromise enzyme activity; therefore, aliquoting the purified enzyme before freezing is strongly recommended. Adding stabilizers such as trehalose (5-10%) or bovine serum albumin (0.1-0.5 mg/mL) can provide additional protection during freeze-thaw cycles.

What statistical approaches are appropriate for analyzing the kinetic parameters of L. cholodnii CobS?

Proper statistical analysis of CobS kinetic data ensures reliable and reproducible results. The following approaches are recommended for different experimental scenarios:

  • Michaelis-Menten kinetics: When determining basic kinetic parameters (Km, Vmax, kcat), non-linear regression using the Michaelis-Menten equation provides more accurate results than linearization methods (e.g., Lineweaver-Burk plots). Analysis software such as GraphPad Prism or R packages like 'drc' are recommended for fitting the data.

  • Evaluation of inhibition mechanisms: For inhibitor studies, statistical comparison of different inhibition models (competitive, uncompetitive, non-competitive, mixed) using the Akaike Information Criterion (AIC) or F-test helps identify the most probable inhibition mechanism.

  • Multivariate analysis for complex kinetics: When CobS exhibits complex kinetics (substrate inhibition, cooperativity), response surface methodology (RSM) can help optimize multiple variables simultaneously.

Statistical MethodApplicationAdvantagesLimitations
Non-linear regressionBasic kinetic parametersDirect fitting without transformationRequires sufficient data points
Global fittingMultiple dataset analysisShares parameters across conditionsComputationally intensive
Bootstrap analysisParameter uncertaintyNo assumptions about error distributionRequires multiple measurements
Monte Carlo simulationError propagationAccounts for all sources of variabilityComplex implementation

For all kinetic analyses, a minimum of three independent experiments with at least 6-8 substrate concentrations spanning 0.2-5 times the Km value is recommended. Technical replicates (n=3) at each concentration improve the reliability of the fitted parameters. Reporting both the best-fit values and their confidence intervals provides a complete picture of the enzyme's kinetic behavior.

How can researchers troubleshoot inconsistent activity in CobS preparations?

Inconsistent activity in CobS preparations can significantly hinder research progress. A systematic troubleshooting approach helps identify and resolve the underlying causes:

  • Verify enzyme quality: SDS-PAGE analysis can confirm the purity and integrity of the recombinant CobS. Western blotting with anti-His antibodies (for His-tagged constructs) verifies the presence of the full-length protein. Mass spectrometry can identify potential modifications or truncations that might affect activity.

  • Check for cofactor availability: As a cobalamin biosynthetic enzyme, CobS requires specific cofactors for activity. The table below outlines key cofactors and their impact on enzyme activity:

CofactorOptimal ConcentrationEffect on Activity if DepletedDetection Method
Cobalt (Co²⁺)5-20 μM80-90% reductionICP-MS, colorimetric assay
ATP2-5 mM100% reductionLuciferase assay
Mg²⁺5-10 mM70-80% reductionAtomic absorption
Reducing environment1-5 mM DTT40-60% reductionDTNB assay
  • Standardize assay conditions: Variations in pH, temperature, and ionic strength can significantly affect CobS activity. The following conditions should be standardized:

    • Buffer composition and pH (±0.1 unit)

    • Temperature control (±1°C)

    • Incubation time (±1 minute)

    • Order of reagent addition

    • Sample preparation method

  • Implement quality control measures: Including positive controls (e.g., previously validated enzyme preparations) and internal standards in each assay batch helps identify systematic errors. Developing a standardized activity unit based on a well-characterized reference reaction enables meaningful comparison across different experiments and laboratories.

By systematically addressing these factors, researchers can significantly improve the consistency and reproducibility of CobS activity measurements, facilitating more reliable data collection and interpretation.

What are the most promising applications of recombinant L. cholodnii CobS in cobalamin research?

Recombinant L. cholodnii CobS offers several promising applications in cobalamin research and biotechnology. The enzyme provides a valuable tool for studying the later stages of cobalamin biosynthesis and potentially developing more efficient production methods for this essential vitamin.

Given that cobalamin biosynthesis requires more than 30 genes and represents a significant metabolic investment for bacteria , recombinant CobS could be utilized in engineered biosynthetic pathways for enhanced cobalamin production. Understanding the specific properties of L. cholodnii CobS may also shed light on how this sheath-forming bacterium has adapted its cobalamin metabolism to its ecological niche.

Furthermore, as cobalamin supplementation has been shown to influence microbial composition in various environments , enzymes like CobS could play a role in developing targeted approaches to modulate microbial communities through metabolic engineering of cobalamin production pathways.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.