Recombinant Leptothrix cholodnii NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nuoA; Lcho_1501; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))
Target Names
nuoA
Target Protein Sequence
MNLENYLPVILFILVGVGVGVAPQVLGFLLGPRRPYAAKNSPYECGFEAFEDARMKFDVR YYLVAILFILFDLEIAFLFPWAVSLREIGATGFWAMMIFLGILVVGFVYEWKKGALDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones in the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this species, ubiquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Leptothrix cholodnii NADH-quinone oxidoreductase subunit A (nuoA)?

Leptothrix cholodnii NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the NADH dehydrogenase I complex (also known as NDH-1 or Complex I) in the respiratory chain of Leptothrix cholodnii. The nuoA protein (UniProt ID: B1Y827) consists of 119 amino acids and functions as a membrane-embedded subunit that contributes to proton translocation across the cell membrane during cellular respiration . This protein is encoded by the nuoA gene, also annotated as Lcho_1501 in the Leptothrix cholodnii genome . Within the bacterial respiratory system, nuoA plays an essential role in energy conservation mechanisms that support the distinctive life cycle and environmental adaptations of this filamentous bacterium.

What expression systems are optimal for recombinant nuoA production?

The optimal expression system for recombinant Leptothrix cholodnii nuoA protein is Escherichia coli, as demonstrated in available commercial preparations . When expressing membrane proteins like nuoA, several E. coli strains have proven effective:

Expression SystemAdvantagesChallengesTag Compatibility
E. coli BL21(DE3)High expression levelsPotential inclusion body formationHis, GST, MBP
E. coli C41(DE3)Specialized for membrane proteinsLower yields than BL21His, FLAG
E. coli RosettaEnhanced expression of proteins with rare codonsHigher costHis, GST, MBP

For optimal expression, the nuoA gene sequence should be codon-optimized for E. coli and placed under control of a strong inducible promoter such as T7 or tac. Expression conditions typically include induction at lower temperatures (16-25°C) to facilitate proper membrane protein folding and minimize aggregation.

What purification methods yield the highest quality recombinant nuoA protein?

Purification of recombinant Leptothrix cholodnii nuoA requires specialized techniques due to its membrane-associated nature. The following protocol has proven successful:

  • Expression with an N-terminal His tag (as seen in commercial preparations)

  • Cell lysis using gentle detergents (e.g., n-dodecyl β-D-maltoside or CHAPS) to solubilize membrane proteins

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography for further purification and detergent exchange

  • Quality assessment via SDS-PAGE (>90% purity)

For structural studies, additional purification steps may be necessary, including ion exchange chromatography. When higher purity is required for enzymatic or structural studies, researchers should consider tag removal using specific proteases (e.g., TEV protease for His-tagged constructs).

How can researchers accurately measure nuoA activity in the context of the NADH dehydrogenase complex?

Measuring nuoA activity requires assessment within the complete NADH dehydrogenase complex, as isolated nuoA does not exhibit independent enzymatic activity. Recommended methodologies include:

  • Reconstitution of nuoA into liposomes alongside other NDH-1 complex subunits

  • NADH:ubiquinone oxidoreductase activity assays using spectrophotometric methods

  • Membrane potential measurements using fluorescent probes (e.g., TMRM or Rhodamine 123)

  • Proton pumping assays using pH-sensitive fluorescent dyes (e.g., ACMA)

When conducting these assays, researchers should establish clear baseline measurements using:

  • Samples lacking nuoA as negative controls

  • Samples with known active NADH dehydrogenase complex as positive controls

  • Assays in the presence of specific inhibitors (e.g., rotenone or piericidin A) to confirm specificity

What analytical techniques are most effective for studying nuoA protein interactions?

Several techniques have proven effective for analyzing nuoA interactions with other components of the respiratory chain:

TechniqueApplicationResolutionSample Requirements
Blue Native PAGENative complex integrityLow-moderateDetergent-solubilized membranes
Co-immunoprecipitationProtein-protein interactionsModerateSpecific antibodies
Surface Plasmon ResonanceBinding kineticsHighPurified components
Crosslinking Mass SpectrometryInteraction interfacesHighPurified components
Cryo-EMStructural contextVery highHighly purified complex

When analyzing protein interactions, researchers should carefully optimize detergent conditions to maintain native protein interactions while solubilizing membrane proteins effectively.

What are the optimal conditions for recombinant nuoA protein reconstitution?

Successful reconstitution of recombinant nuoA protein requires careful attention to buffer composition and environmental conditions:

  • Storage buffer: Tris/PBS-based buffer, pH 8.0, containing 6% trehalose as a stabilizing agent

  • Reconstitution protocol: Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Long-term storage: Add glycerol to a final concentration of 50% and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles

  • Membrane integration: For functional studies, reconstitute into liposomes composed of E. coli polar lipids or synthetic lipids mimicking bacterial membranes

Researchers should verify successful reconstitution through techniques such as dynamic light scattering, circular dichroism, or fluorescence spectroscopy to ensure proper protein folding and membrane integration.

How should researchers troubleshoot expression issues with recombinant nuoA?

When encountering difficulties with nuoA expression, researchers should systematically address the following factors:

  • Codon optimization: Analyze rare codon usage and consider synthetic gene optimization

  • Expression conditions: Test various induction temperatures (16°C, 20°C, 25°C, 30°C) and inducer concentrations

  • Host strain selection: Compare expression in specialized membrane protein expression strains

  • Solubilization screening: Test a panel of detergents for optimal extraction from membranes

  • Fusion partners: Consider expression with solubility-enhancing fusion partners (e.g., MBP, SUMO)

For proteins showing toxicity to host cells, consider using a tightly regulated expression system or using cell-free expression systems as an alternative approach.

How does nuoA contribute to the unique respiratory capabilities of Leptothrix cholodnii?

Leptothrix cholodnii is known for its distinctive filamentous growth and sheath formation, which requires significant energy resources. The nuoA protein, as part of the NADH dehydrogenase complex, plays a crucial role in energy generation for these processes. Current evidence suggests:

  • The NADH dehydrogenase complex containing nuoA is likely upregulated during active filament extension and sheath formation

  • The energy provided by respiratory chain activity supports both cellular division and the extensive extracellular matrix production observed in Leptothrix cholodnii

  • The respiratory chain may contribute to the bacterium's adaptation to various oxygen levels in aquatic environments

Further research is needed to establish direct correlations between nuoA expression levels and phenotypic characteristics of Leptothrix cholodnii, particularly regarding filament and sheath formation.

How does Leptothrix cholodnii nuoA compare structurally and functionally to homologs in other bacteria?

Comparative analysis of nuoA across bacterial species reveals both conserved and divergent features:

Bacterial SpeciesnuoA LengthKey Structural DifferencesFunctional Implications
Leptothrix cholodnii119 aaStandard membrane-spanning domainsNormal proton pumping activity
Escherichia coli118 aaHighly similar transmembrane topologyWell-characterized model system
Thermus thermophilus114 aaAdaptations for thermostabilityEnhanced stability at high temperatures
CyanobacteriaVariableAdditional domains in some speciesPotential interaction with photosynthetic machinery

What insights can nuoA provide about the evolution of respiratory chains in environmental bacteria?

Studying nuoA from Leptothrix cholodnii offers valuable perspectives on respiratory chain evolution:

  • As a member of the Burkholderiales order, Leptothrix cholodnii represents an important branch in beta-proteobacterial evolution

  • Comparative genomic analysis of nuoA can reveal selection pressures acting on respiratory chains in bacteria adapted to metal-rich aquatic environments

  • The integration of respiratory chain function with specialized traits like sheath formation provides insights into how core metabolic processes can be recruited to support novel ecological adaptations

  • Understanding nuoA evolution may inform research on the development of efficient biological systems for bioremediation and environmental applications

Researchers interested in evolutionary perspectives should consider conducting phylogenetic analyses incorporating nuoA sequences from diverse bacterial lineages, particularly focusing on those with similar environmental niches.

What methodological advances would enhance our understanding of nuoA function?

Several emerging technologies and approaches could significantly advance nuoA research:

  • Cryo-electron microscopy to resolve high-resolution structures of the complete NADH dehydrogenase complex from Leptothrix cholodnii

  • Single-molecule FRET studies to observe conformational changes during the catalytic cycle

  • CRISPR-based genome editing in Leptothrix cholodnii to create precise mutations for in vivo functional studies

  • Computational modeling of proton translocation pathways involving nuoA

  • Integration of multi-omics approaches (proteomics, transcriptomics, metabolomics) to understand nuoA regulation in response to environmental conditions

How might nuoA research inform our understanding of Leptothrix cholodnii's ecological role?

Expanding nuoA research has potential implications for understanding broader ecological questions:

  • The relationship between respiratory chain efficiency and the ability of Leptothrix cholodnii to thrive in specific aquatic environments

  • How energy generation through nuoA and other respiratory components supports the formation of microbial mats and biofilms in natural settings

  • The potential role of nuoA in adaptation to varying oxygen tensions in stratified water columns

  • Connections between respiratory chain function and the bacterium's ability to oxidize and precipitate metals in the environment

Future ecological studies should consider incorporating measurements of respiratory chain activity alongside observations of Leptothrix cholodnii behavior in natural and engineered environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.