Recombinant Leptothrix cholodnii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Complex I in Bacterial Physiology

  • Proton Translocation: Complex I is a major proton-pumping complex in bacteria, critical for ATP synthesis .

  • Genomic Organization: In L. cholodnii, nuoK is part of the nuo operon (nuoA–nuoN), as observed in other bacteria .

B. Leptothrix cholodnii Biology

  • Sheath Formation: While nuoK is unrelated to sheath biosynthesis, L. cholodnii produces glycoconjugate sheaths via glycosyltransferases like LthA and LthB .

  • Nutrient Limitation: Calcium depletion disrupts sheath formation and filament integrity, though no direct link to nuoK has been established .

Related Subunits and Complex I Components

Recombinant production of Complex I subunits is common, with L. cholodnii nuoK being one of many available:

SubunitOrganismFunctionReference
nuoALeptothrix cholodniiCore subunit of Complex I .
nuoKAnaeromyxobacter dehalogenansAnalogous to L. cholodnii nuoK .
NDH-1SphaerotilusHomologous to L. cholodnii sheath-related GTs .

Gaps and Future Directions

Current literature lacks functional studies on L. cholodnii nuoK. Key gaps include:

  • Mechanistic Role: How nuoK contributes to Complex I activity in L. cholodnii.

  • Physiological Impact: Linkages between nuoK expression and metabolic adaptations under nutrient stress.

  • Evolutionary Context: Comparative analysis of nuoK across Leptothrix species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing it for you.
Synonyms
nuoK; Lcho_1511; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))
Target Names
nuoK
Target Protein Sequence
MVALGHYLTLGAILFALSVIGIFLNRKNLIVLLMCIELMLLAVNLNFVAFSHYLGDMAGQ VFVFFILTVAAAESAIGLAILVVLFRNRSTINVDELDTLKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this particular species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Leptothrix cholodnii and why is it significant in research?

Leptothrix cholodnii is a filamentous bacterium known for forming cell chains encased in sheaths composed of woven nanofibrils. The bacterium has gained significant research interest due to its unique morphological characteristics and its presence in wastewater treatment systems. L. cholodnii SP-6 (formerly classified as L. discophora) serves as a model filament-forming organism and is frequently found in bulking activated sludge in industrial wastewater treatment plants . The bacterium's ability to form complex microbial mats makes it an important subject for studying bacterial community structures and biofilm formation mechanisms .

What is the function of NADH-quinone oxidoreductase in bacterial systems?

NADH-quinone oxidoreductase, also known as Complex I or NADH dehydrogenase, plays a crucial role in bacterial respiratory chains. This enzyme complex catalyzes the transfer of electrons from NADH to quinone, coupled with proton translocation across the membrane. This process contributes to the establishment of a proton gradient that drives ATP synthesis. In L. cholodnii, this enzyme complex is particularly important for energy generation under the microaerobic conditions often encountered in its natural habitat, such as in wastewater treatment systems and aquatic environments where oxygen gradients exist .

What is known about the nuoK subunit's structure and location within the NADH-quinone oxidoreductase complex?

The nuoK subunit is one of the membrane-embedded components of the NADH-quinone oxidoreductase complex. While the search results don't provide specific structural details for L. cholodnii nuoK, research on homologous subunits in other bacteria suggests that nuoK contains multiple transmembrane helices and participates in forming the proton translocation pathway. The subunit likely interacts closely with other membrane subunits (such as nuoH, nuoJ, and nuoL) to maintain the structural integrity of the proton-pumping machinery.

What are the optimal conditions for expressing recombinant L. cholodnii nuoK?

Expressing recombinant L. cholodnii nuoK requires careful optimization of culture conditions. Based on L. cholodnii growth studies, researchers should consider the following parameters:

  • Medium composition: Use a defined medium similar to MSVP (mineral salts vitamin pyruvate) that contains essential nutrients for L. cholodnii growth .

  • Nutrient requirements: Ensure adequate supplies of Ca²⁺ and Mg²⁺, as these divalent cations are critical for L. cholodnii growth. Research has shown that limitations in Mg²⁺ can result in cell autolysis, while Ca²⁺ limitation leads to filament disintegration .

  • Expression system selection: For heterologous expression, E. coli systems with tightly controlled promoters are recommended to prevent potential toxicity from membrane protein overexpression.

  • Temperature optimization: Lower temperatures (around 18-22°C) during induction may improve proper folding of this membrane protein.

  • Induction parameters: Use lower inducer concentrations and longer expression times to promote proper membrane integration.

What methodologies are most effective for studying nuoK function in the context of L. cholodnii physiology?

To effectively study nuoK function in L. cholodnii, researchers should employ a multi-faceted approach:

How does nutrient limitation affect the expression and function of nuoK in L. cholodnii?

Nutrient limitation significantly impacts L. cholodnii growth patterns and likely affects nuoK expression and function. Research has identified four distinct morphological changes in L. cholodnii filamentous growth under nutrient limitation:

  • Normal growth: Observed with limitations in Na⁺, K⁺, and Fe²⁺

  • Patchy growth: Observed with limitations in carbon, nitrogen, phosphorus, and vitamins

  • Non-viable growth: Observed with Mg²⁺ limitation

  • Fragmented growth: Observed with Ca²⁺ limitation

While specific effects on nuoK expression have not been directly reported, these nutrient conditions likely influence respiratory chain component expression. Under carbon limitation, cells may downregulate energy-intensive processes, potentially affecting nuoK expression. The catastrophic effects of Ca²⁺ and Mg²⁺ limitation suggest these ions may play important roles in maintaining membrane integrity, which could directly impact membrane-embedded proteins like nuoK.

Researchers should investigate nuoK expression levels under these different nutrient conditions using qRT-PCR or proteomics approaches to understand how respiratory chain components respond to environmental stress.

What is the relationship between nuoK function and filament formation in L. cholodnii?

The relationship between nuoK function and filament formation represents an intriguing research question. L. cholodnii's filamentous growth is characterized by cell-chain elongation and sheath formation, processes that require substantial energy. As a component of the respiratory chain, nuoK likely plays a role in generating the energy needed for these morphological developments.

To investigate this relationship, researchers should:

  • Compare respiratory chain activity with filament elongation rates under different growth conditions.

  • Examine whether nuoK mutants show altered filament formation patterns.

  • Determine if changes in membrane potential (which could be affected by nuoK function) correlate with changes in filament integrity.

The observation that certain nutrient limitations lead to filament fragmentation suggests possible connections between energy metabolism and structural integrity that warrant further investigation .

How might studying nuoK contribute to understanding the ecological role of L. cholodnii in wastewater treatment systems?

L. cholodnii is present in bulking activated sludge in industrial wastewater treatment plants, where excessive growth can negatively impact treatment efficiency . Understanding nuoK's role in energy metabolism could provide insights into controlling L. cholodnii proliferation in these systems.

Research approaches should include:

The finding that simultaneous limitation of Ca²⁺ and carbon sources can stimulate planktonic cell generation instead of filamentous growth suggests potential strategies for managing filamentous growth in treatment systems by manipulating specific nutrients to affect energy metabolism.

What purification strategies are most effective for isolating recombinant nuoK for structural studies?

Purifying membrane proteins like nuoK presents significant challenges. Based on current membrane protein purification methodologies, the following approach is recommended:

  • Membrane extraction: Use a gentle detergent like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) to solubilize the membrane fraction containing nuoK.

  • Affinity chromatography: Express nuoK with an affinity tag (His-tag or FLAG-tag) to facilitate initial purification.

  • Size exclusion chromatography: Further purify the protein using size exclusion to separate nuoK from other membrane components.

  • Stability assessment: Test different buffer conditions including various detergents, lipids, and stabilizing agents to maintain protein integrity.

  • Purity verification: Use SDS-PAGE, Western blotting, and mass spectrometry to confirm the identity and purity of the isolated nuoK.

For structural studies, consider reconstitution into nanodiscs or amphipols, which can provide a more native-like environment than detergent micelles.

What assays can be employed to measure nuoK activity within the NADH-quinone oxidoreductase complex?

Assessing nuoK activity requires indirect approaches since it's part of a larger complex. Recommended methodologies include:

  • NADH oxidation assays: Measure the rate of NADH oxidation spectrophotometrically (decrease in absorbance at 340 nm) in membrane preparations or purified complex.

  • Proton pumping assays: Use pH-sensitive fluorescent dyes to monitor proton translocation activity in reconstituted proteoliposomes containing the complex.

  • Electron transfer kinetics: Employ stopped-flow spectroscopy to measure electron transfer rates within the complex.

  • Quinone reduction assays: Monitor the reduction of quinone analogs (such as decylubiquinone) spectrophotometrically.

  • Membrane potential measurements: Use fluorescent dyes sensitive to membrane potential to assess the contribution of the complex to generating membrane potential in intact cells or membrane vesicles.

To specifically assess nuoK's contribution, compare these activities between wild-type complexes and those with site-directed mutations in nuoK or in nuoK-depleted preparations.

How should researchers interpret changes in nuoK expression in relation to L. cholodnii morphology?

When analyzing correlations between nuoK expression and L. cholodnii morphology, researchers should consider:

  • Temporal relationship: Determine whether changes in nuoK expression precede or follow morphological changes to establish causality.

  • Dose-response relationship: Quantify how different levels of nuoK expression correlate with specific morphological parameters (filament length, sheath thickness, cell chain integrity).

  • Environmental context: Interpret expression changes in relation to specific nutrient limitations or environmental stressors. For instance, the four morphological growth modes identified in L. cholodnii under different nutrient limitations (normal, patchy, non-viable, and fragmented) may each have distinctive nuoK expression profiles.

  • Systems perspective: Analyze nuoK expression as part of broader transcriptomic or proteomic changes to identify coordinated responses.

  • Statistical validation: Apply appropriate statistical methods to distinguish significant correlations from background variation, using replicate samples and appropriate controls.

What bioinformatic approaches are most valuable for analyzing nuoK sequence conservation and predicting functional domains?

For comprehensive bioinformatic analysis of nuoK, researchers should employ:

  • Multiple sequence alignment: Compare nuoK sequences across diverse bacterial species to identify conserved residues that may be functionally important.

  • Phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary relationships between nuoK variants and identify potential functional divergence.

  • Structural prediction: Use tools like AlphaFold2 or RoseTTAFold to predict the three-dimensional structure of nuoK, particularly focusing on transmembrane regions and potential interaction surfaces.

  • Protein-protein interaction prediction: Employ docking algorithms to model interactions between nuoK and other subunits of the NADH-quinone oxidoreductase complex.

  • Functional domain annotation: Identify conserved domains using databases like Pfam and InterPro to predict functional regions within the protein.

  • Coevolution analysis: Apply methods like statistical coupling analysis to identify co-evolving residues that may be functionally linked.

These analyses can guide experimental design, particularly for site-directed mutagenesis studies targeting functionally important residues.

How might nuoK research contribute to understanding the broader respiratory adaptations of L. cholodnii in diverse environments?

Future research on nuoK should explore its role in L. cholodnii's adaptation to different environmental conditions. Key research directions include:

  • Investigating nuoK expression and modification under varying oxygen tensions, as L. cholodnii likely encounters microaerobic conditions in its natural habitats.

  • Examining potential alternate electron acceptors that might interact with the respiratory chain under oxygen-limited conditions, and how these affect nuoK function.

  • Studying the impact of metal ions, particularly Fe²⁺, on respiratory chain assembly and function, given L. cholodnii's known interactions with metals in the environment.

  • Exploring how nuoK and the respiratory chain respond to the transition between planktonic and filamentous growth states, particularly under calcium and carbon co-limitation conditions .

  • Investigating potential interactions between respiratory chain function and sheath formation, as both processes occur at the cell membrane interface.

What experimental approaches could elucidate the potential role of nuoK in the catastrophic disintegration of filaments observed under calcium limitation?

The observation that calcium limitation leads to catastrophic disintegration of L. cholodnii filaments raises intriguing questions about membrane integrity and potential connections to respiratory chain components like nuoK. To investigate this relationship, researchers should:

  • Employ time-lapse microscopy with fluorescently labeled nuoK to track its localization during filament disintegration under calcium limitation.

  • Use membrane potential-sensitive dyes to monitor changes in membrane energetics during calcium limitation and filament fragmentation.

  • Develop calcium-responsive biosensors to monitor intracellular calcium levels in relation to nuoK activity and filament integrity.

  • Perform comparative proteomics on intact filaments versus fragmented filaments to identify changes in membrane protein composition, including respiratory chain components.

  • Conduct mutagenesis studies of nuoK to identify residues that might be involved in calcium-dependent filament stability.

This research could reveal important connections between energy metabolism, membrane integrity, and the structural characteristics that define L. cholodnii's filamentous growth pattern.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.