Recombinant Leptothrix cholodnii Probable intracellular septation protein A (Lcho_1840)

What is Lcho_1840 and what is its basic function in Leptothrix cholodnii?

Lcho_1840 is annotated as a probable intracellular septation protein A belonging to the YciB family in Leptothrix cholodnii. It functions primarily in cell division processes and is believed to be involved in intracellular septation. As a multi-pass inner membrane protein, it plays a critical role in maintaining cell envelope integrity in this sheath-forming bacterium commonly found in aquatic environments.

The protein consists of 212 amino acids with a molecular mass of approximately 23.2 kDa, and its sequence (MKLFLDFLPIILFFLTFKVAEGRAEEAAAFATEHLGALVSGGVVGAAEAPVLLATVVVILATLAQVLYLKLRGQKVDTMLWVSLGLVTVMGGATIWFHSETFIKWKPSVLYWVMSAAFLLAPIVAGKDLLRAMLGGQIELPAFAWKKLNLAWAAFFAGMGVLNIWVAYNFSTSTWATFKAFGGMGLMFVFMLAQGLYMHRHMKVDGIKADES) indicates its highly hydrophobic nature, consistent with its membrane localization .

How does Lcho_1840 relate to other proteins in the YciB family?

Lcho_1840 belongs to the YciB family of proteins, which are widely conserved among bacteria and involved in cell envelope biogenesis and membrane homeostasis. While direct studies on Lcho_1840 remain limited, its function can be inferred from homologous systems and genomic annotations.

Notably, a comparable protein, IspA from Shigella flexneri, has been better characterized. IspA is essential for virulence and affects several functions of the virulence process. Mutation in ispA leads to defects in cell division, resulting in the formation of long filamentous bacteria lacking septa. Additionally, the mutation affects the ability to polymerize actin, a prerequisite for intra- and inter-cellular spreading ability . Given the functional similarity within the YciB family, Lcho_1840 likely plays comparable roles in Leptothrix cholodnii, particularly in maintaining proper cell division and membrane integrity.

What is known about the structure and localization of Lcho_1840?

Lcho_1840 is a multi-pass inner membrane protein with highly hydrophobic characteristics. Its amino acid sequence analysis reveals multiple transmembrane domains consistent with its membrane integration. The protein has a predicted molecular weight of 23.2 kDa, which can be visualized via SDS-PAGE, though the actual molecular weight may vary depending on tag type and expression method .

Subcellular localization studies confirm that Lcho_1840 is primarily situated in the inner membrane of Leptothrix cholodnii cells. This localization is critical for its function in cell envelope maintenance and septation processes. Unlike sheath-related glycosyltransferases (such as LthA and LthB), Lcho_1840's expression is not regulated by extracellular calcium levels, highlighting its distinct functional pathway in membrane-associated processes.

What are the optimal conditions for expressing recombinant Lcho_1840?

For optimal expression of recombinant Lcho_1840, researchers should consider the following protocol based on established methods for membrane proteins:

Expression System Selection:

• E. coli BL21(DE3) or C43(DE3) strains are recommended for membrane protein expression

• Consider using pET or pBAD vector systems with inducible promoters

Culture Conditions:

• Initial growth at 37°C until OD600 reaches 0.6-0.8

• Reduce temperature to 16-18°C prior to induction

• Induce with 0.1-0.5 mM IPTG (for pET systems) or 0.002-0.02% L-arabinose (for pBAD systems)

• Continue expression for 16-20 hours at the reduced temperature

Buffer Optimization:

• Lysis buffer: 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol

• Addition of mild detergents such as 1% n-dodecyl-β-D-maltoside (DDM) or 1% Triton X-100 for membrane protein solubilization

The recombinant protein should achieve >85% purity when verified by SDS-PAGE. For long-term storage, lyophilized formulations with 6% trehalose or glycerol-stabilized aliquots are recommended to ensure stability during shipping and extended storage periods.

How can researchers effectively purify Lcho_1840 while maintaining its native structure?

Purification of Lcho_1840 while preserving its native structure requires careful consideration of its membrane protein characteristics:

Solubilization Steps:

• Harvest cells and resuspend in buffer containing 50 mM Tris-HCl pH 7.5, 150 mM NaCl

• Disrupt cells via sonication or pressure homogenization

• Centrifuge at low speed (5,000×g) to remove unbroken cells

• Ultracentrifuge the supernatant (100,000×g for 1 hour) to isolate membrane fractions

• Solubilize membrane fraction with gentle detergents (1% DDM or 0.5% n-octyl-β-D-glucopyranoside)

Purification Protocol:

• Affinity chromatography using His-tag or other fusion tags (if incorporated)

• Size exclusion chromatography to remove aggregates and ensure protein homogeneity

• Optional: Ion exchange chromatography as a polishing step

Critical Factors for Maintaining Native Structure:

• Maintain detergent concentration above critical micelle concentration throughout purification

• Include 10-15% glycerol in all buffers to stabilize membrane proteins

• Add protease inhibitors to prevent degradation

• Perform all steps at 4°C to minimize denaturation

• Consider incorporation of lipids (0.01-0.1 mg/ml) to stabilize native conformation

Using this approach, researchers can achieve >85% purity while maintaining the native structure necessary for functional studies.

What assays can be used to assess the functional activity of Lcho_1840?

Several complementary approaches can be employed to assess the functional activity of Lcho_1840:

Complementation Assays:

• Generate knockout strains of Leptothrix cholodnii lacking Lcho_1840

• Reintroduce wild-type or mutant forms of Lcho_1840

• Evaluate restoration of phenotypes (cell morphology, chain formation, septation)

• Similar to approaches used with YciB family proteins in other bacteria

Membrane Integrity Assays:

• Propidium iodide uptake to assess membrane permeability

• Fluorescent dye leakage assays to quantify membrane integrity

• Differential scanning calorimetry to assess membrane stability

Cell Division Analysis:

• Microscopy-based assessment of septation using fluorescent membrane stains

• Time-lapse imaging to track division progression

• Quantification of chain length and morphology

• Assessment of filamentous phenotypes similar to those observed in ispA mutants

Protein-Protein Interaction Studies:

• Co-immunoprecipitation with known cell division proteins

• Bacterial two-hybrid assays to identify interaction partners

• Cross-linking studies to capture transient interactions

These methodological approaches provide a comprehensive assessment of Lcho_1840's functional role in cellular processes, particularly those related to septation and membrane integrity .

How does Lcho_1840 contribute to sheath formation in Leptothrix cholodnii?

While Lcho_1840 is not directly involved in sheath nanofibril synthesis (a process primarily mediated by glycosyltransferases like LthA and LthB), its role in membrane integrity and cell division indirectly affects sheath formation:

Indirect Contribution Mechanisms:

• Structural Continuity Maintenance: By ensuring proper septation during cell division, Lcho_1840 maintains the structural continuity necessary for coherent sheath formation around the cell chain.

• Membrane Architecture: As a membrane protein involved in cell envelope integrity, Lcho_1840 likely contributes to the proper organization of membrane components required for the secretion and assembly of sheath material.

• Cell Chain Formation: Leptothrix cholodnii generates cell chains encased in sheaths composed of woven nanofibrils. Proper cell division and chain formation, facilitated by Lcho_1840, are prerequisites for the characteristic sheathed morphology .

Unlike glycosyltransferases directly involved in nanofibril synthesis, Lcho_1840's membrane-localized activity suggests an indirect role in maintaining the cellular infrastructure necessary for proper sheath development and integrity. This is particularly important considering that Leptothrix nanofibrils are mainly composed of glycoconjugate repeats [→4)-α-GalA-(1→4)-β-GlcNAc-(1→3)-β-GalNAc-(1→4)-α-GalNAAc-(1→4)-α-GalNAc-(1→] with modifications such as cysteine residue addition .

What phenotypic changes occur in Lcho_1840 knockout or mutant strains?

Based on studies of related proteins in the YciB family and inferences from homologous systems, Lcho_1840 knockout or mutant strains would likely exhibit several distinctive phenotypic changes:

Drawing parallels from the ispA mutant in Shigella flexneri, Lcho_1840 mutants would likely show increasing defects in cell division, leading to the formation of long filamentous bacteria lacking septa . Unlike direct sheath biosynthesis mutants (such as LthB knockouts that completely lack nanofibrils), Lcho_1840 mutants would likely retain the ability to produce sheath material but fail to properly organize it around the cell chains due to disrupted cell division processes .

How does Lcho_1840 function compare with other YciB family proteins in different bacterial species?

Comparative analysis of Lcho_1840 with other YciB family proteins reveals both conserved and species-specific functions:

Conserved Functions Across YciB Family:

• Membrane localization and topology

• Involvement in cell envelope integrity

• Role in septation and cell division processes

• Highly hydrophobic protein structure

Species-Specific Adaptations:

• Shigella flexneri IspA:

  • Critical for virulence and intercellular spreading

  • Essential for actin polymerization

  • Mutants form filamentous bacteria trapped within host cells

  • Directly impacts pathogenicity

• Escherichia coli YciB:

  • Located between trp and tonB genes

  • Functions primarily in membrane homeostasis

  • Less directly involved in pathogenicity

  • Serves as a model for basic YciB family characterization

• Leptothrix cholodnii Lcho_1840:

  • Adapted for filamentous growth pattern

  • Indirectly supports sheath formation

  • Functions in aquatic environmental context

  • Not directly involved in virulence mechanisms

This comparative analysis highlights how YciB family proteins maintain core structural and functional properties while adapting to the specific biological requirements of their respective bacterial species. In Leptothrix cholodnii, Lcho_1840 has likely evolved to support the unique sheathed, filamentous growth pattern characteristic of this aquatic bacterium .

How can Lcho_1840 be used as a model for studying membrane protein dynamics in filamentous bacteria?

Lcho_1840 serves as an excellent model system for studying membrane protein dynamics specifically in filamentous bacteria for several reasons:

Experimental Approaches:

• Fluorescent Protein Fusions:

  • Creating Lcho_1840-GFP fusions enables real-time visualization of protein localization during cell division

  • Time-lapse microscopy can track dynamic redistribution during septation

  • Photobleaching recovery experiments can measure lateral diffusion rates within the membrane

• Cryoelectron Tomography:

  • Allows visualization of Lcho_1840 in its native membrane environment

  • Can capture different conformational states during the cell cycle

  • Provides structural context for protein function in relation to septation machinery

• Site-Directed Spin Labeling:

  • Strategic placement of spin labels throughout Lcho_1840

  • Electron paramagnetic resonance (EPR) spectroscopy to measure conformational changes

  • Assess dynamics in different lipid environments mimicking the natural membrane

• Single-Molecule Tracking:

  • Quantum dot labeling of individual Lcho_1840 molecules

  • Super-resolution microscopy to track movement patterns

  • Correlation with cell division events and septation site formation

These approaches collectively provide insights into how membrane proteins like Lcho_1840 coordinate their distribution and activity during the complex process of filamentous bacterial growth, offering a model that extends beyond Leptothrix to other environmentally important filamentous bacteria.

What are the current challenges in studying Lcho_1840 and how might they be addressed?

Research on Lcho_1840 faces several significant challenges that require innovative methodological approaches:

Challenge 1: Limited Genetic Tools for Leptothrix cholodnii

• Problem: Unlike model organisms, genetic manipulation tools for L. cholodnii are underdeveloped.

• Solution: Adapt Tn10 mutagenesis approaches similar to those used in Shigella studies . Additionally, develop CRISPR-Cas9 systems optimized for Leptothrix, focusing on homology-directed repair templates designed specifically for high-GC content genomes.

Challenge 2: Membrane Protein Expression and Purification

• Problem: Membrane proteins like Lcho_1840 are notoriously difficult to express and purify in functional form.

• Solution: Employ specialized expression systems such as C43(DE3) E. coli strains designed for membrane proteins. Utilize nanodiscs or amphipols as alternative solubilization strategies to conventional detergents, better preserving native lipid interactions.

Challenge 3: Functional Assays in Native Context

• Problem: Assessing function outside the native cell environment is challenging.

• Solution: Develop liposome reconstitution systems incorporating natural Leptothrix membrane lipids. Generate spheroplasts from Leptothrix cells for patch-clamp studies of membrane properties. Employ microfluidic systems to track single-cell phenotypes over time.

Challenge 4: Structural Determination

• Problem: The hydrophobic nature of Lcho_1840 complicates structural studies.

• Solution: Apply cryo-EM techniques optimized for membrane proteins. Utilize integrative structural biology approaches combining limited proteolysis, cross-linking mass spectrometry, and computational modeling. Consider stabilizing nanobodies or single-domain antibodies to facilitate crystallization.

Challenge 5: Connecting to Broader Sheath Formation Process

• Problem: Establishing the relationship between septation and sheath formation is complex.

• Solution: Employ correlative light and electron microscopy (CLEM) to simultaneously visualize Lcho_1840 localization and sheath ultrastructure. Develop in situ cryo-electron tomography protocols to capture the intact cellular architecture during division and sheath formation .

How might post-translational modifications affect Lcho_1840 function?

Post-translational modifications (PTMs) potentially play crucial yet largely unexplored roles in regulating Lcho_1840 function:

Predicted PTMs and Their Functional Implications:

• Phosphorylation:

  • Probable sites: Serine and threonine residues in cytoplasmic loops

  • Potential kinases: Bacterial serine/threonine kinases responsive to environmental signals

  • Functional impact: May regulate protein-protein interactions during septation

  • Detection method: Phosphoproteomic analysis using titanium dioxide enrichment followed by LC-MS/MS

• Lipid Modifications:

  • Predicted modifications: N-terminal lipidation or palmitoylation

  • Functional impact: Could anchor specific regions to the membrane or facilitate interaction with other membrane components

  • Detection method: Metabolic labeling with alkyne-tagged lipid precursors followed by click chemistry visualization

• Disulfide Bond Formation:

  • Lcho_1840 contains cysteine residues that may form intra- or inter-molecular disulfide bonds

  • Functional impact: May regulate protein conformation or oligomerization state

  • Detection method: Non-reducing vs. reducing SDS-PAGE followed by mass spectrometry

• Proteolytic Processing:

  • N-terminal or internal cleavage may generate functional protein fragments

  • Functional impact: Could activate the protein or generate fragments with distinct functions

  • Detection method: N-terminal sequencing and western blotting with domain-specific antibodies

Experimental Approach to Study PTM Impact:

A comprehensive strategy would involve site-directed mutagenesis of predicted modification sites, replacing modifiable residues with non-modifiable analogs (e.g., serine to alanine for phosphorylation sites). The resulting mutants would be evaluated for:

• Altered localization using fluorescence microscopy

• Changes in protein-protein interaction profiles

• Effects on membrane topology

• Functional consequences for cell division and septation

This approach would clarify how PTMs contribute to the spatiotemporal regulation of Lcho_1840 during the complex process of filamentous bacterial growth and division.

How does Lcho_1840 compare with septation proteins in other sheath-forming bacteria?

Comparative analysis reveals both conserved and distinct features between Lcho_1840 and septation proteins in other sheath-forming bacteria:

Comparative Features Across Sheath-Forming Bacteria:

In all these bacteria, septation proteins like Lcho_1840 appear to maintain the cellular architecture necessary for proper sheath formation without directly participating in sheath material synthesis. This functional separation between septation and sheath biosynthesis appears to be an evolutionary conserved feature .

The key distinction lies in how these proteins interact with the species-specific sheath formation machinery. While glycosyltransferases like LthA and LthB are directly involved in nanofibril biosynthesis in Leptothrix cholodnii, the YciB family proteins maintain the cellular framework upon which these species-specific sheath structures are assembled .

What evolutionary insights can be gained from studying Lcho_1840 and related proteins?

Studying Lcho_1840 provides valuable evolutionary insights into bacterial membrane biology and specialization:

Evolutionary Patterns and Implications:

• Core Membrane Protein Conservation:

  • YciB family proteins are widely conserved across diverse bacterial phyla

  • This conservation suggests an ancient and fundamental role in bacterial cell biology

  • The core transmembrane topology has been maintained despite substantial sequence divergence

• Functional Adaptation:

  • While maintaining core membrane functions, YciB homologs have specialized in different bacterial lifestyles

  • In pathogens like Shigella, the homolog (IspA) became integrated into virulence mechanisms

  • In environmental bacteria like Leptothrix, Lcho_1840 adapted to support filamentous growth and sheath formation

• Gene Context Evolution:

  • In E. coli, the homolog is positioned between trp and tonB genes

  • Genomic context analysis across species reveals how these genes became associated with different functional pathways

  • Mobile genetic elements likely played a role in this diversification, similar to the IS element insertion observed in Lcho_0972

• Selective Pressures:

  • Comparison of synonymous vs. non-synonymous substitution rates reveals regions under differential selection

  • Transmembrane domains show higher conservation than loop regions

  • This pattern suggests stronger selective pressure on regions critical for membrane integration

These evolutionary insights highlight how a conserved membrane protein family has diversified to support specialized bacterial lifestyles, from environmental sheath formation to pathogenic host invasion, while maintaining core structural and functional properties .

How might insights from Lcho_1840 research inform studies of bacterial septation across species?

Research on Lcho_1840 has broad implications for understanding bacterial septation across diverse species:

Translational Research Applications:

• Model for Studying Filamentous Growth:

  • Lcho_1840's role in the filamentous growth of Leptothrix provides a model for studying similar processes in other environmentally and medically important filamentous bacteria

  • The mechanisms of septation in chain-forming bacteria may inform research on biofilm formation and antibiotic resistance

• Membrane Protein Dynamics During Division:

  • Insights into how Lcho_1840 redistributes during septation could inform broader models of membrane protein dynamics

  • The coordination between membrane remodeling and septation is a universal challenge for bacterial cells

• Potential Antimicrobial Targets:

  • Understanding conserved features of YciB family proteins might reveal vulnerabilities that could be exploited for antibiotic development

  • Unlike direct cell wall synthesis inhibitors, targeting membrane organization during division represents an alternative approach

• Environmental Adaptation Mechanisms:

  • How Lcho_1840 supports the specialized sheathed morphology of Leptothrix illustrates mechanisms of bacterial adaptation to specific ecological niches

  • This informs ecological models of bacterial community formation in aquatic environments

• Methodological Advances:

  • Techniques developed to study this challenging membrane protein can be applied to other systems

  • Particularly relevant are approaches combining genetic manipulation with advanced imaging to correlate genotype with phenotype

By serving as a model system for studying septation in filamentous bacteria, Lcho_1840 research contributes to a broader understanding of bacterial cell biology across diverse species and environments, bridging environmental microbiology with more traditional model systems .

What are the most promising future research directions for Lcho_1840?

Several high-potential research directions for Lcho_1840 could significantly advance understanding of this protein and bacterial septation more broadly:

• Structural Determination:

  • High-resolution structural studies using cryo-EM or X-ray crystallography

  • Membrane protein structural biology techniques to determine transmembrane organization

  • Conformational changes during the cell cycle and division process

• Interaction Network Mapping:

  • Comprehensive identification of protein interaction partners using proximity labeling approaches

  • Temporal dynamics of interaction networks throughout the cell cycle

  • Comparative interactomics across different bacterial species with YciB homologs

• In Situ Functional Analysis:

  • Development of optogenetic tools to control Lcho_1840 activity with light

  • Microfluidic systems for long-term observation of single cells under controlled conditions

  • Correlative microscopy techniques linking protein localization to cellular ultrastructure

• Environmental Adaptation Studies:

  • Examination of Lcho_1840 function under various environmental conditions

  • Response to stressors common in aquatic environments

  • Adaptation mechanisms in relation to sheath formation and protection

• Synthetic Biology Applications:

  • Engineering Lcho_1840 variants with enhanced or modified functions

  • Development of biosensors based on Lcho_1840 conformational changes

  • Exploration of biotechnological applications for controlled bacterial chain formation

These research directions collectively aim to deepen understanding of Lcho_1840's role in bacterial septation while exploring potential applications in biotechnology and environmental microbiology.

How can insights from Lcho_1840 research be applied to broader fields of microbiology?

Insights from Lcho_1840 research have significant implications for multiple areas of microbiology:

Environmental Microbiology:

• Understanding the mechanisms of sheath formation in iron-oxidizing bacteria like Leptothrix

• Insights into biofilm formation in aquatic environments

• Models for bacterial adaptation to specific ecological niches

Structural Microbiology:

• Advances in membrane protein structural biology techniques

• Understanding the relationship between protein structure and bacterial morphology

• Models for membrane reorganization during cell division

Molecular Microbiology:

• Identification of conserved mechanisms in bacterial cell division

• Understanding specialized adaptations of universal cellular processes

• Models for protein localization and dynamics in bacterial cells

Applied Microbiology:

• Potential biotechnological applications of sheath-forming bacteria

• Development of new approaches for controlling bacterial growth

• Applications in environmental remediation using engineered Leptothrix strains

Medical Microbiology:

• Comparative analysis with virulence-associated septation proteins like IspA

• Identification of new antimicrobial targets

• Understanding antibiotic resistance mechanisms related to cell division

By connecting fundamental aspects of bacterial cell biology with specialized adaptations in environmental bacteria, Lcho_1840 research bridges multiple disciplines within microbiology, contributing to a more integrated understanding of bacterial life .

What technical innovations are needed to advance research on Lcho_1840 and related proteins?

Advancing research on Lcho_1840 and related proteins requires several technical innovations:

• Genetic Tool Development:

  • CRISPR-Cas9 systems optimized for Leptothrix cholodnii

  • Inducible gene expression systems for controlled protein production

  • Reporter systems compatible with sheath-forming bacteria

  • Transposon libraries for high-throughput functional genomics

• Advanced Imaging Techniques:

  • Super-resolution microscopy protocols optimized for bacterial chains

  • Live-cell imaging compatible with sheath structures

  • Correlative light and electron microscopy workflows

  • Cryo-electron tomography of intact bacterial chains

• Membrane Protein Analysis:

  • Nanodiscs or other membrane mimetics specific to Leptothrix membranes

  • Native mass spectrometry for membrane protein complexes

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Single-molecule force spectroscopy for membrane protein unfolding

• Computational Methods:

  • Improved algorithms for membrane protein structure prediction

  • Systems biology models of cell division in filamentous bacteria

  • Machine learning approaches for phenotypic analysis of bacterial chains

  • Molecular dynamics simulations in realistic membrane environments

• High-Throughput Functional Assays:

  • Microfluidic platforms for growth and division analysis

  • Flow cytometry approaches compatible with bacterial chains

  • Automated image analysis for morphological phenotyping

  • Multiplexed assays for membrane integrity and function