Recombinant Leptothrix cholodnii Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ubiB; Lcho_4010; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))
Target Names
ubiB
Target Protein Sequence
MKNWPRLAFIAWVLLRQGMDQLVLSHMPHASLRLLARLMSIGRTHHEPRGVRLRMALERL GPIFVKFGQVLSTRRDLIPHDIANELAKLQDRVPPFPSDVSRAAVVQSLGRPIEEVFASF DADPVASASIAQVHFGVLHDGREVAVKVLRPNVLNIIEADLALLRVAAAWLERLSPDGRR LRPREVVAEFDNYLHDELDLGREAANAAQLRRNMGGLDLIMLPEMIWDLSSAEVLVMERM HGVPISQIETLRAAGIDIPKLARDGVTIFFTQVFRDGFFHADMHPGNIMVSTAPATFGRY IALDFGIVGTLDSRDKEYLAQNFLAFFRRDYRRVAELHIESGWVPASTRVDELEGAVRAV CEPHFDRPLKDISLGQVLLRLFQTSRRFNVEIQPQLVLLQKTLLNVEGLGRQLDPELDLW QTAKPFLERWMNEQVGWRALLGSIKDEAPRYAKLLPELPRLLHDALQAHARPQRPSDELL LALLHEQRRTNRLLLTVFYLIGGFVAGGLFAHWILPGLLHLL
Uniprot No.

Target Background

Function
This recombinant Leptothrix cholodnii protein, likely a protein kinase regulator, modulates UbiI activity, which is involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is UbiB and what is its primary function in Leptothrix cholodnii?

UbiB in Leptothrix cholodnii is classified as a probable protein kinase involved in ubiquinone biosynthesis. Ubiquinone (UQ) is a key liposoluble proton carrier used in respiratory chains of eukaryotes and proteobacteria, essential for generating the electrochemical gradient that powers ATP synthesis. In L. cholodnii, the UbiB protein (UniProt ID: B1XWR5) is encoded by the ubiB gene (locus Lcho_4010) and plays a critical role in the electron transport chain processes . Unlike hydroxylases such as UbiF, UbiH, and UbiI that modify specific positions on the aromatic ring during UQ biosynthesis, UbiB appears to function earlier in the pathway, potentially facilitating the initial steps of UQ formation that are necessary for cellular respiration.

How has the UbiB protein been structurally characterized and what domains are critical for its function?

Current structural characterization of L. cholodnii UbiB remains limited, but comparative analysis with better-studied bacterial UbiB proteins reveals several conserved domains typical of kinases. These include:

  • ATP-binding pocket: Essential for phosphorylation activity

  • Substrate recognition domains: Allow specific interaction with pathway intermediates

  • Membrane-association regions: Enable localization to sites of ubiquinone biosynthesis

Research suggests that UbiB's kinase activity is crucial for activating precursor molecules in the UQ biosynthesis pathway. While detailed crystallographic structures of L. cholodnii UbiB have not been published, molecular modeling based on homologous proteins indicates a folding pattern consistent with other members of the protein kinase superfamily . Mutational studies of homologous UbiB proteins suggest that altering conserved residues in the predicted ATP-binding domain abolishes function, emphasizing the critical nature of this region for enzymatic activity.

What expression systems are most effective for producing recombinant L. cholodnii UbiB protein?

For recombinant expression of L. cholodnii UbiB, E. coli-based systems have proven most effective. Specifically, the protein has been successfully expressed with N-terminal His-tags to facilitate purification . The optimal expression protocol involves:

  • Cloning the ubiB gene (Lcho_4010) into vectors containing strong inducible promoters (e.g., T7)

  • Transformation into E. coli expression strains optimized for membrane-associated proteins

  • Induction with IPTG at reduced temperatures (16-20°C) to enhance proper folding

  • Careful lysis using detergent-based buffers to solubilize the membrane-associated protein

Expression yields can be maximized by maintaining cultures at 37°C until reaching OD600 of 0.6-0.8, then reducing temperature to 18°C prior to induction. Purification typically employs immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins, followed by size exclusion chromatography to achieve high purity . Storage in Tris-based buffers with 50% glycerol at -20°C helps maintain protein stability and enzymatic activity.

What are the established methods for gene replacement of ubiB in L. cholodnii?

Gene replacement of ubiB in L. cholodnii can be accomplished using conjugation-based methods with E. coli S17-1 as the donor strain . The protocol involves:

  • Construction of a replacement vector:

    • Amplification of 1.5 kb upstream and downstream regions flanking the ubiB gene

    • Integration of a kanamycin resistance cassette (Kmr) and spoVG terminator

    • Assembly of these elements into a mobilizable plasmid (e.g., pUC18-mob)

  • Conjugation procedure:

    • Pre-treatment of L. cholodnii cells under calcium-depleted conditions to reduce sheath formation

    • Mixing L. cholodnii recipient cells with E. coli S17-1 donor cells at an optimized ratio

    • Incubation on non-selective plates for 16-24 hours

    • Selection on kanamycin-containing media to identify transformants

  • Verification of gene replacement:

    • PCR-based validation using primers flanking the insertion site

    • Sequencing to confirm proper integration

    • Phenotypic analysis to assess the effects of ubiB deletion

This methodology has been successfully applied to other genes in L. cholodnii (e.g., Lcho_0008, Lcho_3510) and can be adapted for ubiB with appropriate primer design and optimization of conjugation conditions. The calcium depletion step is particularly crucial as it prevents formation of the nanofibril sheath that would otherwise inhibit DNA transfer .

What analytical techniques are most reliable for assessing UbiB function in ubiquinone biosynthesis?

Multiple complementary techniques are necessary to comprehensively assess UbiB function in ubiquinone biosynthesis:

  • HPLC-MS/MS Analysis:

    • Extraction of ubiquinone and intermediates using hexane/methanol mixtures

    • Reverse-phase HPLC coupled with tandem mass spectrometry

    • Monitoring of characteristic ubiquinone transitions (e.g., m/z 863→197 for UQ-10)

    • Quantification against isotopically labeled standards

  • In vitro Kinase Activity Assays:

    • Purified recombinant UbiB incubated with ATP and putative substrates

    • Detection of phosphorylated products using 32P-labeled ATP or anti-phospho antibodies

    • Analysis of reaction kinetics to determine enzyme parameters (Km, Vmax)

  • Complementation Studies:

    • Introduction of L. cholodnii ubiB into E. coli ubiB knockout strains

    • Assessment of restored ubiquinone production and respiratory function

    • Growth analysis under conditions requiring functional electron transport chain

  • Metabolic Labeling:

    • Incorporation of 13C-labeled precursors into the ubiquinone pathway

    • Tracking of label through intermediates to final ubiquinone product

    • Identification of accumulating intermediates in ubiB mutants

These methods collectively provide insights into both the biochemical activity of UbiB and its physiological role in the cellular context . The integration of these approaches has revealed that UbiB likely functions as a protein kinase in the early steps of ubiquinone biosynthesis, activating pathway components through phosphorylation.

How does UbiB function relate to the filamentous growth and sheath formation in L. cholodnii?

UbiB's role in ubiquinone biosynthesis appears to be integrated with L. cholodnii's distinctive filamentous growth pattern and sheath formation, though through indirect mechanisms. Research indicates:

  • Energy metabolism connection: UbiB facilitates ubiquinone production, which is crucial for generating the energy required for proper cell division and filament elongation. Disruptions in ubiquinone biosynthesis could potentially alter cell energetics and impact the formation of characteristic cell chains .

  • Redox state influence: The electron transport chain, in which ubiquinone plays a central role, affects the cellular redox state. This redox balance has been shown to influence sheath formation in L. cholodnii, particularly in relation to metal oxidation processes that contribute to the extracellular matrix .

  • Relationship to oxygen sensing: As an aerobic bacterium that forms pellicles at air-liquid interfaces, L. cholodnii's growth pattern is strongly influenced by oxygen availability. UbiB's role in respiratory function may contribute to the bacterium's oxygen-seeking behavior and subsequent filament development at well-aerated surfaces .

What environmental conditions affect UbiB expression and activity in L. cholodnii?

The expression and activity of UbiB in L. cholodnii are influenced by several environmental factors:

Environmental FactorEffect on UbiB Expression/ActivityPhysiological Impact
Oxygen concentrationUpregulated under aerobic conditionsEnhanced ubiquinone production for aerobic respiration
Carbon source availabilityIncreased expression with higher carbon availabilitySupports energy metabolism for filament elongation
Divalent cation levels (Ca²⁺, Mg²⁺)Ca²⁺ depletion may indirectly affect UbiB functionDisrupts filament integrity and potentially energy metabolism
Iron availabilityMay coordinate with iron acquisition systemsAffects both respiration and metal oxidation activities
Growth phaseHigher expression during exponential growthSupports increased metabolic demands during active growth

Unlike sheath-formation proteins such as LthA whose expression is directly regulated by calcium concentration , UbiB expression appears to be more closely tied to metabolic requirements. The protein's activity is likely optimal under conditions that favor aerobic respiration and filamentous growth, aligning with L. cholodnii's ecological role as an aerobic, filament-forming bacterium in freshwater environments . Research indicates that nutrient limitations affecting central metabolism (C, N, P) would consequently impact UbiB function and downstream ubiquinone production.

How does UbiB compare functionally to other proteins involved in L. cholodnii's distinctive metabolism?

UbiB functions as part of a metabolic network that supports L. cholodnii's distinctive lifestyle, with important functional relationships to other key proteins:

  • Comparison with sheath formation proteins:

    • LthA and LthB (glycosyltransferases) directly synthesize nanofibril components for the sheath structure

    • UbiB contributes indirectly by supporting energy production necessary for sheath biosynthesis

    • While LthA/B deletion causes immediate loss of sheath, UbiB disruption would likely produce more complex metabolic phenotypes

  • Relationship to flagellar proteins:

    • FlgA/B components enable swimming motility through flagella function

    • UbiB enables energy production that powers flagellar rotation

    • Both systems contribute to L. cholodnii's ability to reach air-liquid interfaces where pellicles form

  • Integration with iron oxidation systems:

    • L. cholodnii oxidizes iron as part of its distinctive metabolism

    • Electron transport (supported by UbiB-produced ubiquinone) interfaces with metal oxidation

    • Both systems contribute to the bacterium's ecological niche in iron-rich freshwater environments

This integrated view demonstrates that while specialized proteins like LthA/B directly create L. cholodnii's distinctive morphological features, UbiB belongs to the core metabolic machinery that provides the energetic foundation for these specialized functions. Understanding these relationships is crucial for developing comprehensive models of L. cholodnii biology and potentially controlling its growth in environmental and industrial contexts .

How has UbiB evolved across different bacterial lineages and what does this reveal about ubiquinone biosynthesis pathways?

Phylogenetic analysis of UbiB across bacterial lineages reveals fascinating evolutionary patterns in ubiquinone biosynthesis:

  • Distribution patterns:

    • UbiB is widely distributed across proteobacteria but with significant sequence variation

    • Alphaproteobacteria, betaproteobacteria (including L. cholodnii), and gammaproteobacteria show distinct UbiB clades

    • Some bacterial lineages have lost UbiB through genome reduction events

  • Functional specialization:

    • In some bacteria, UbiB functions appear to have been distributed among multiple specialized proteins

    • Other bacteria, particularly those with reduced genomes, employ generalist enzymes with broader substrate specificity

    • L. cholodnii's UbiB appears to maintain ancestral functions without extensive specialization

  • Evolutionary implications:

    • UbiB likely emerged in an ancestral proteobacterium over 2 billion years ago

    • Its evolution parallels the development of aerobic respiration following Earth's oxygenation

    • Conservation of key domains suggests fundamental constraints on protein function despite sequence divergence

This evolutionary perspective indicates that ubiquinone biosynthesis pathways have undergone significant remodeling across bacterial lineages, with varying degrees of specialization versus generalization of enzyme functions. L. cholodnii's UbiB retains characteristics suggesting a relatively conserved functional role compared to some more specialized systems found in other proteobacteria . The retention of UbiB across diverse bacterial lineages underscores its critical importance in maintaining effective respiratory metabolism.

What functional differences exist between UbiB and related proteins like UbiF, UbiH, and UbiI in the ubiquinone biosynthesis pathway?

UbiB differs fundamentally from UbiF, UbiH, and UbiI in both structure and function within the ubiquinone biosynthesis pathway:

ProteinEnzymatic FunctionStructural FeaturesPosition in UQ PathwayPresence in L. cholodnii
UbiBProbable protein kinase; activates pathway componentsKinase domain; ATP-binding siteEarly stepsPresent (Lcho_4010)
UbiFFlavin monooxygenase; hydroxylation of C-5FAD-binding domain; substrate channelLate stepsUnknown/Not annotated
UbiHFlavin monooxygenase; hydroxylation of C-6FAD-binding domain; different substrate specificityMid-pathwayUnknown/Not annotated
UbiIFlavin monooxygenase; hydroxylation of C-2FAD-binding domain; regiospecific active siteMid-pathwayUnknown/Not annotated

The key distinction is that UbiF, UbiH, and UbiI are hydroxylases that modify specific carbon positions on the aromatic ring during UQ biosynthesis, while UbiB appears to function as a kinase that phosphorylates and activates other pathway components . In many proteobacteria, these three hydroxylases perform specific modifications, but evolutionary analysis reveals that some bacteria have developed generalist enzymes capable of performing multiple hydroxylation reactions. For example, UbiM in some proteobacteria can hydroxylate three positions, while UbiL can modify two positions .

L. cholodnii's genome annotation does not clearly identify orthologs of all these specific hydroxylases, suggesting it may utilize alternative or generalist enzymes for some of these functions. This diversity in enzyme distribution highlights the evolutionary plasticity of ubiquinone biosynthesis pathways across bacterial lineages.

What insights do comparative genomic approaches provide about the role of UbiB in L. cholodnii compared to other bacteria?

Comparative genomic analyses offer valuable insights into the role of UbiB in L. cholodnii relative to other bacterial species:

  • Genomic context analysis:

    • In L. cholodnii, ubiB (Lcho_4010) appears to be part of an operon structure different from that in E. coli

    • Neighboring genes may include other components of electron transport or ubiquinone biosynthesis

    • This genomic organization suggests potential co-regulation with specific metabolic pathways

  • Protein domain comparison:

    • L. cholodnii UbiB contains conserved kinase domains found in other bacterial UbiB proteins

    • Sequence alignments reveal high conservation in ATP-binding regions across diverse bacteria

    • Some variations in peripheral domains suggest adaptations to specific cellular environments

  • Presence/absence patterns:

    • UbiB is consistently present in aerobic proteobacteria including L. cholodnii

    • Some bacteria with reduced genomes have lost dedicated UbiB but maintain ubiquinone production

    • These patterns suggest UbiB's role is critical but potentially replaceable in certain genomic contexts

The persistence of ubiB in the L. cholodnii genome, which has not undergone extensive reduction, indicates its importance in maintaining optimal metabolic function in this environmentally adaptable bacterium . While some bacteria have evolved alternative pathways or more generalist enzymes, L. cholodnii appears to maintain a relatively conventional ubiquinone biosynthesis pathway that includes UbiB as a key component. This conservation likely reflects the importance of efficient energy metabolism in supporting L. cholodnii's distinctive lifestyle as a filamentous, sheath-forming bacterium in freshwater environments.

How can UbiB be utilized as a target for controlling filamentous bacterial growth in industrial settings?

UbiB represents a promising target for controlling filamentous bacterial growth in industrial settings, particularly in water treatment facilities where Leptothrix species contribute to bulking and clogging problems:

  • Targeted inhibition strategies:

    • Development of small-molecule inhibitors specific to UbiB's kinase activity

    • These could disrupt energy metabolism without broad antimicrobial effects

    • Structure-based drug design could exploit unique features of L. cholodnii UbiB

  • Metabolic management approach:

    • Manipulation of environmental conditions to modulate UbiB expression

    • Combined nutrient limitation strategies affecting both carbon utilization and calcium availability

    • Research shows that limiting both carbon and calcium inhibits filament formation in Leptothrix species

  • Genetic engineering applications:

    • Development of conditional UbiB expression systems for biocontrol strains

    • Engineering competitor bacteria to express UbiB inhibitors

    • Creation of biosensors that detect and respond to Leptothrix proliferation

A particularly promising approach combines understanding of UbiB function with insights into calcium-dependent filament formation in L. cholodnii. Research demonstrates that simultaneous limitation of carbon and calcium prevents filamentous growth and stimulates planktonic cell generation . This suggests that integrated strategies targeting both energy metabolism (via UbiB) and sheath formation could effectively control problematic filamentous growth in industrial systems without requiring complete eradication of the bacteria.

What are the most promising techniques for studying protein-protein interactions involving UbiB in the ubiquinone biosynthesis pathway?

Advanced techniques for investigating UbiB's protein-protein interactions in the ubiquinone biosynthesis pathway include:

  • Proximity-based labeling methods:

    • BioID or APEX2 fusions to UbiB expressed in L. cholodnii

    • These enzymes biotinylate proteins in close proximity when activated

    • Mass spectrometry identification of biotinylated proteins reveals interaction partners

    • Particularly valuable for capturing transient interactions in membrane-associated complexes

  • Cryo-electron microscopy (Cryo-EM):

    • Visualization of UbiB-containing protein complexes at near-atomic resolution

    • Sample preparation optimized for membrane-associated protein assemblies

    • Structural determination of UbiB in complex with substrate proteins

    • 3D reconstruction of the ubiquinone biosynthetic machinery

  • Chemical crosslinking coupled with mass spectrometry (XL-MS):

    • In vivo or in vitro crosslinking of UbiB complexes

    • MS/MS analysis of crosslinked peptides to identify interaction sites

    • Distance constraints between interacting residues

    • Integration with molecular modeling to reconstruct complex architecture

  • Split-protein complementation assays:

    • UbiB and potential partners fused to complementary fragments of reporter proteins

    • Expression in L. cholodnii or heterologous systems

    • Interaction reconstitutes reporter activity (fluorescence, luminescence, etc.)

    • Allows monitoring of interactions in living cells under various conditions

Implementation of these techniques requires adaptation to L. cholodnii's genetic system using the recently developed gene replacement methods . The gene transfer protocols involving conjugation with E. coli S17-1 under optimized conditions provide a pathway for introducing engineered UbiB constructs for interaction studies. These approaches will help elucidate how UbiB interfaces with other components of the ubiquinone biosynthesis pathway and potentially reveal new functional connections to L. cholodnii's distinctive metabolism.

What are the unresolved questions about UbiB that present the most significant opportunities for future research?

Several critical unresolved questions about UbiB present exciting opportunities for future research:

  • Substrate specificity and enzymatic mechanism:

    • What are the specific substrates phosphorylated by UbiB?

    • What is the precise catalytic mechanism of the phosphorylation reaction?

    • How is UbiB activity regulated in response to cellular energy status?

    • Does L. cholodnii UbiB exhibit unique substrate preferences compared to other bacterial UbiB proteins?

  • Structural biology frontiers:

    • What is the three-dimensional structure of L. cholodnii UbiB?

    • How does UbiB bind ATP and recognize its substrates?

    • What conformational changes occur during the catalytic cycle?

    • How does UbiB integrate into membrane structures where ubiquinone biosynthesis occurs?

  • Physiological role in L. cholodnii biology:

    • How does UbiB activity coordinate with the distinctive filamentous growth pattern?

    • What metabolic adaptations occur when UbiB function is compromised?

    • How does UbiB function relate to the bacterium's metal oxidation activities?

    • Can UbiB manipulation be used to control problematic growth in industrial settings?

  • Evolutionary adaptations in ubiquinone biosynthesis:

    • How has UbiB function adapted to different ecological niches across bacterial lineages?

    • What selective pressures maintain UbiB versus alternative pathways?

    • Has horizontal gene transfer played a role in UbiB distribution?

    • What can UbiB evolutionary patterns tell us about the history of respiratory metabolism?

Addressing these questions will require integration of multiple experimental approaches, including the recently developed genetic tools for L. cholodnii . The gene replacement methodology using conjugation with E. coli S17-1 provides a pathway for creating targeted UbiB variants to probe structure-function relationships. Combined with advanced biochemical characterization and in vivo imaging techniques, these approaches could transform our understanding of this important protein and its role in bacterial metabolism.

What strategies can address poor expression or solubility issues when working with recombinant UbiB protein?

Poor expression or solubility of recombinant L. cholodnii UbiB can be addressed through several optimization strategies:

  • Expression system modifications:

    • Test specialized E. coli strains designed for membrane proteins (C41/C43, Lemo21)

    • Evaluate different fusion tags beyond His6 (MBP, SUMO, TrxA) to enhance solubility

    • Optimize codon usage for the expression host

    • Consider cell-free expression systems for difficult constructs

  • Expression condition optimization:

    • Reduce induction temperature to 16-20°C to slow folding and prevent aggregation

    • Decrease inducer concentration to moderate expression rate

    • Add specific additives to growth media (glycerol, sorbitol, arginine)

    • Test auto-induction media for gentler protein production

  • Solubilization approaches:

    • Screen multiple detergents (DDM, LDAO, CHAPS) for optimal extraction

    • Test detergent-lipid mixtures that better mimic native membrane environment

    • Evaluate mild solubilization conditions over extended periods

    • Consider amphipol or nanodisc reconstitution for downstream applications

  • Construct engineering:

    • Generate truncated versions to identify and remove problematic regions

    • Create chimeric proteins with well-expressed homologs

    • Introduce stabilizing mutations based on homology modeling

    • Remove putative aggregation-prone sequences

Successful recombinant expression of L. cholodnii UbiB typically involves using Tris-based buffers with 50% glycerol for storage, as indicated in commercial preparations . For purification, a combination of immobilized metal affinity chromatography followed by size exclusion chromatography in detergent-containing buffers often yields the best results. When properly optimized, these approaches can generate sufficient quantities of functional protein for biochemical and structural studies.

How can researchers troubleshoot issues with gene replacement methods for ubiB in L. cholodnii?

When troubleshooting gene replacement of ubiB in L. cholodnii, researchers should consider the following strategies:

  • Conjugation efficiency problems:

    • Ensure complete calcium depletion pretreatment of L. cholodnii (critical for reducing sheath that blocks DNA transfer)

    • Optimize donor:recipient ratio (typically starting with 1:5 to 1:10)

    • Extend conjugation time to 24-48 hours for difficult transfers

    • Use fresh cultures in exponential growth phase

    • Reduce antibiotic concentration in selection plates if no transformants are recovered

  • Plasmid construction issues:

    • Ensure sufficient homology regions (≥1.5 kb on each side of ubiB)

    • Verify correct orientation of all components via sequencing

    • Include a strong transcriptional terminator (e.g., spoVG) to prevent polar effects

    • Use high-fidelity polymerases for all PCR steps to prevent unwanted mutations

  • Verification challenges:

    • Design multiple primer sets for confirmation PCR (flanking, internal, junction-specific)

    • Use both positive and negative controls for all verification steps

    • Consider whole-genome sequencing to confirm single insertion at the correct locus

    • Verify phenotypic changes consistent with UbiB disruption

  • Specific considerations for ubiB:

    • If UbiB is essential, attempt conditional knockdown approaches instead

    • Consider deletion of a non-essential portion rather than the entire gene

    • Provide complementation in trans if complete deletion is lethal

    • Attempt replacement under various growth conditions that might reduce dependence on UbiB

The established protocol involving pUC18-mob-based constructs and E. coli S17-1 conjugation has been successful for other genes in L. cholodnii , but each target presents unique challenges. Particular attention should be paid to the calcium depletion step and donor:recipient ratio optimization when working with this filamentous bacterium.

What are the key considerations when designing experiments to characterize UbiB mutants in L. cholodnii?

When designing experiments to characterize UbiB mutants in L. cholodnii, researchers should consider these critical factors:

  • Growth condition selection:

    • Compare growth under aerobic vs. microaerobic conditions to assess respiratory defects

    • Test different carbon sources that vary in their requirements for electron transport chain function

    • Evaluate growth at different temperatures to identify conditional phenotypes

    • Monitor growth in liquid culture and on solid media to assess different growth modes

  • Phenotypic characterization approaches:

    • Microscopic examination of filament formation (length, morphology, fragmentation)

    • Analysis of sheath development using transmission and scanning electron microscopy

    • Quantification of pellicle formation at air-liquid interfaces

    • Measurement of swimming motility which depends on cellular energetics

  • Metabolic assessment:

    • Quantification of ubiquinone levels using HPLC-MS/MS

    • Profiling of pathway intermediates to identify accumulation points

    • Measurement of oxygen consumption rates to assess respiratory function

    • Determination of ATP production capacity under various conditions

  • Control experiments:

    • Include wild-type and complemented mutant strains in all experiments

    • Generate point mutants in key UbiB domains to distinguish functional regions

    • Compare ubiB mutants to other respiratory chain mutants to identify shared phenotypes

    • Conduct time-course experiments to distinguish primary from secondary effects

  • Specialized analyses:

    • Transcriptomic profiling to identify compensatory responses

    • Metabolomic analysis to detect broad metabolic alterations

    • Proteomic studies to identify changes in protein abundance

    • In vivo imaging using fluorescent probes for membrane potential or cellular energetics

Given L. cholodnii's distinctive biology, particular attention should be paid to effects on filamentous growth, sheath formation, and pellicle development at air-liquid interfaces. The recently established methods for genetic manipulation in L. cholodnii provide valuable tools for creating defined mutations and complemented strains for these analyses . Integration of these approaches will provide a comprehensive understanding of UbiB's role in this fascinating filamentous bacterium.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.