Recombinant Leptothrix cholodnii Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
lgt; Lcho_1492; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) (Leptothrix discophora (strain SP-6))
Target Names
lgt
Target Protein Sequence
MLVHPQFNPIALDLGFFQIHWYGLTYLAAFGLFYFLATRRIRQAPYASGSGPAWTARDVE DLLFFGVVGVILGGRLGYVLFYKPTYYLANLSEIPAVWKGGMAFHGGLLGVIVAMALFAH LRGRKFFEVTDLVAPCVPTGLAMGRIGNFINGELWGRAADASLPWAMVFPQSGSDLPRHP SQLYQFALEGLALFALTWFYGHSRSAHVGADGRPIWGRVSGLFVGGYGVFRFIAEYFREP DSFLGLLAFNLSMGQWLCVPMIVAGALIWWSAGRRRV
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Lgt in Leptothrix cholodnii?

Lgt (prolipoprotein diacylglyceryl transferase) in L. cholodnii functions as an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway of lipoprotein biogenesis. Similar to its function in other bacteria such as E. coli, L. cholodnii Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the cysteine residue in the conserved lipobox of prolipoproteins. This modification is crucial for membrane anchoring of lipoproteins that are involved in various cellular processes, including cell envelope maintenance, nutrient uptake, and potentially, sheath formation . The gene is identified as Lcho_1492 in the genome of L. cholodnii, and its functional significance is underscored by the fact that deletion of lgt genes is often lethal in Gram-negative bacteria, suggesting similarly essential roles in L. cholodnii .

What expression systems are optimal for producing recombinant L. cholodnii Lgt?

For effective expression of recombinant L. cholodnii Lgt, researchers should consider the following methodological approaches:

  • Expression system selection: As Lgt is an integral membrane protein, specialized expression systems that accommodate membrane protein production are recommended. E. coli C41(DE3) or C43(DE3) strains, designed for membrane protein expression, often yield better results than standard BL21(DE3).

  • Vector design: Incorporate a mild promoter (such as pBAD or trc rather than T7) to prevent toxic accumulation. Include fusion tags that facilitate both expression and purification, such as a combination of His-tag and MBP (maltose-binding protein).

  • Expression conditions optimization:

    ParameterRecommended RangeNotes
    Temperature16-25°CLower temperatures reduce inclusion body formation
    Inducer concentration0.1-0.5 mM IPTG or 0.002-0.02% arabinoseStrain and vector dependent
    Expression time12-18 hoursExtended time at lower temperatures
    MediaTerrific Broth with 0.5-1% glucoseGlucose for tighter regulation of expression
  • Solubilization and purification: Use gentle detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) for membrane extraction. Purification should include both affinity chromatography and size exclusion steps to ensure protein homogeneity .

When evaluating expression, researchers should confirm both quantity and quality of the recombinant protein through Western blot and activity assays to ensure that the expressed protein maintains its native conformation and functionality.

How can researchers investigate the substrate specificity of L. cholodnii Lgt?

Investigating substrate specificity of L. cholodnii Lgt requires a multifaceted approach combining structural, biochemical, and genetic techniques:

  • Synthetic peptide library screening: Design peptide libraries containing variations of the lipobox consensus sequence (typically [LVI][ASTVI][GAS][C]) to determine the sequence preferences of L. cholodnii Lgt. Use in vitro assays with purified recombinant Lgt and radiolabeled or fluorescently labeled phosphatidylglycerol to quantify the transfer efficiency for different peptide substrates.

  • Structural analysis: Leverage the existing crystal structure information from E. coli Lgt (1.9 Å resolution) to model the substrate binding pocket of L. cholodnii Lgt . Perform site-directed mutagenesis of predicted substrate-interacting residues, particularly focusing on the conserved arginine residues (homologous to Arg143 and Arg239 in E. coli) that are essential for catalytic activity.

  • In vivo complementation assays: For functional validation, design a complementation system using an E. coli lgt conditional knockout strain. Express L. cholodnii Lgt variants and assess their ability to restore viability and lipoprotein processing.

  • Lipid substrate preference analysis: Test various phospholipid donors beyond phosphatidylglycerol using an in vitro assay system with purified components. Quantify transfer efficiency using HPLC or mass spectrometry-based methods to detect modified lipoproteins.

  • Data analysis framework:

    MeasurementAnalysis MethodExpected Output
    Transfer rateMichaelis-Menten kineticsKm and Vmax for different substrates
    Substrate preferenceRelative activity (%)Rank order of preferred lipobox sequences
    Lipid donor selectivityCompetitive binding assaysRelative affinity constants
    Structure-functionMolecular dynamics simulationsBinding energy calculations

Interpretation of results should account for differences between in vitro and in vivo environments, particularly considering the membrane-embedded nature of the enzyme and potential accessory factors present in the native L. cholodnii context .

What role might Lgt play in the unique filamentous growth pattern of Leptothrix cholodnii?

The potential role of Lgt in L. cholodnii's filamentous growth pattern represents a complex research question requiring integrative experimental approaches:

  • Gene deletion studies: Create an lgt knockout or conditional knockdown strain using the recently developed gene replacement methods for L. cholodnii SP-6, such as the approach described by Kunoh et al. . Since complete lgt deletion might be lethal (as in other Gram-negative bacteria), inducible expression systems or partial knockdowns may be necessary. Monitor changes in cell chain formation, nanofibril production, and sheath development.

  • Localization studies: Employ fluorescently tagged Lgt (ensuring the tag doesn't interfere with function) to determine its subcellular localization during different stages of filament formation. Correlate Lgt distribution patterns with cell division sites and nanofibril production regions.

  • Interaction network mapping: Identify Lgt interaction partners through techniques like pull-down assays coupled with mass spectrometry or bacterial two-hybrid systems, focusing on proteins involved in:

    • Cell division machinery

    • Glycosyltransferases involved in nanofibril formation (like the identified LthA and LthB)

    • Sheath formation proteins

  • Lipoprotein profiling: Compare the lipoprotein profiles of wild-type and Lgt-depleted cells using proteomics approaches to identify specific lipoproteins that might directly participate in filament or sheath formation.

  • Microfluidic analysis: Utilize microfluidic devices similar to those described by Kunoh et al. to monitor single-filament dynamics under conditions where Lgt activity is modulated. This approach enables real-time observation of how altered Lgt function affects filament elongation patterns, directional growth, and response to obstacles.

The research should specifically investigate whether Lgt-modified lipoproteins contribute to the "unilateral" or "bilateral" elongation patterns observed when nanofibrils cap the cell pole or surround the cell waist, respectively . Additionally, researchers should examine if Lgt-dependent lipoproteins influence how filaments respond upon collision with obstacles, where they either bend or reverse direction depending on the angle of collision .

How does the mechanism of L. cholodnii Lgt compare with the structurally characterized E. coli Lgt?

A comprehensive comparison between L. cholodnii Lgt and E. coli Lgt requires a methodical approach combining structural biology, biochemistry, and computational tools:

  • Homology modeling and structural comparison: Using the high-resolution crystal structure of E. coli Lgt (1.9 Å resolution) as a template , generate a homology model of L. cholodnii Lgt. Key areas for structural comparison include:

    • The two binding sites identified in E. coli Lgt

    • The predicted membrane topology and transmembrane domains

    • The architecture of the active site pocket

    • Conservation of critical residues like Arg143 and Arg239 (E. coli numbering)

  • Functional conservation validation: Perform cross-species complementation experiments by expressing L. cholodnii Lgt in E. coli lgt-knockout cells. Assess whether complementation restores wild-type phenotypes and lipoprotein processing.

  • Catalytic mechanism comparison: Conduct site-directed mutagenesis of predicted catalytic residues in L. cholodnii Lgt, based on known essential residues in E. coli. Measure enzymatic activity using assays such as:

    ParameterAssay MethodComparison Metrics
    Reaction kineticsRadiolabeled phosphatidylglycerol incorporationKm, Vmax, and catalytic efficiency
    pH dependenceActivity measurements across pH range 5.0-9.0Optimal pH, Henderson-Hasselbalch plots
    Cation requirementsActivity with various divalent cationsRelative activity percentages
    Inhibitor sensitivityPalmitic acid inhibition constantsKi values, inhibition mechanisms
  • Substrate entry/exit pathway analysis: E. coli Lgt data supports a mechanism where "substrate and product enter and leave the enzyme laterally relative to the lipid bilayer" . Investigate whether this lateral access model applies to L. cholodnii Lgt through molecular dynamics simulations and targeted mutagenesis of residues predicted to line the lateral opening.

  • Evolutionary context analysis: Perform phylogenetic analysis comparing Lgt sequences across diverse bacterial species, with special attention to other filamentous bacteria. This may provide insights into whether any unique features of L. cholodnii Lgt correlate with its filamentous lifestyle .

The research should highlight both conserved features that reflect the fundamental Lgt mechanism and any L. cholodnii-specific adaptations that might relate to its unique ecological niche or cellular organization.

What are the optimal conditions for assaying L. cholodnii Lgt enzymatic activity?

Establishing optimal conditions for L. cholodnii Lgt activity assays requires systematic optimization of multiple parameters. Researchers should consider the following methodological approach:

  • Preparation of active enzyme:

    • Purify recombinant Lgt in mild detergents (DDM or LMNG) to maintain native conformation

    • Consider reconstitution into proteoliposomes or nanodiscs to provide a lipid bilayer environment

    • Verify protein integrity through circular dichroism and thermal shift assays prior to activity measurements

  • Assay components optimization:

    ComponentRecommended RangeOptimization Approach
    Buffer systemHEPES, Tris, or phosphate (pH 7.0-8.0)Test activity across pH range 6.0-9.0 in 0.5 unit increments
    Salt concentration100-300 mM NaClTitrate NaCl from 0-500 mM
    Divalent cations1-10 mM Mg²⁺ or Mn²⁺Compare activity with different cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺)
    Reducing agents0.5-5 mM DTT or β-mercaptoethanolDetermine minimum concentration needed for maximum activity
    Detergent2× CMC of DDM or LMNGTest various detergents at concentrations above their critical micelle concentration
  • Substrate preparation and presentation:

    • Synthesize peptide substrates containing the lipobox motif (consensus sequence [LVI][ASTVI][GAS][C])

    • Prepare phosphatidylglycerol in small unilamellar vesicles or mixed micelles with detergent

    • For initial assays, consider using fluorescently labeled or radiolabeled phosphatidylglycerol

  • Activity detection methods:

    • Direct measurement: Use radiolabeled (³²P or ³H) phosphatidylglycerol and measure incorporation into peptide substrates

    • Indirect measurement: Monitor release of by-products using coupled enzyme assays

    • Mass spectrometry: Track substrate-to-product conversion using MALDI-TOF or LC-MS/MS

  • Assay validation controls:

    • Positive control: E. coli Lgt with known activity

    • Negative controls: Heat-inactivated enzyme; reaction missing essential components

    • Specificity control: Non-lipobox peptides that should not serve as substrates

When interpreting results, researchers should account for the membrane-bound nature of Lgt and how the in vitro environment (detergents, artificial membranes) might affect its activity compared to its native membrane context. Optimal conditions established in vitro should be verified through functional complementation assays where possible .

What approaches can be used to study structure-function relationships in L. cholodnii Lgt?

Investigating structure-function relationships in L. cholodnii Lgt requires an integrated approach combining computational prediction, site-directed mutagenesis, and functional characterization:

  • Computational structural analysis:

    • Generate homology models based on the E. coli Lgt crystal structure (1.9 Å resolution)

    • Identify conserved domains, active site residues, and substrate binding regions

    • Predict transmembrane topology using programs like TMHMM, TOPCONS, and MEMSAT

    • Perform molecular dynamics simulations to understand protein flexibility and substrate binding

  • Systematic mutagenesis strategy:

    • Target conserved residues, especially those corresponding to the critical Arg143 and Arg239 in E. coli Lgt

    • Create alanine-scanning mutations across predicted catalytic and substrate-binding regions

    • Design chimeric proteins with domains swapped between L. cholodnii and E. coli Lgt to identify species-specific functional regions

  • Expression and purification of variant proteins:

    • Express wild-type and mutant proteins under identical conditions to allow direct comparison

    • Verify proper folding and membrane integration through circular dichroism and thermal stability assays

    • Assess oligomeric state through size exclusion chromatography and native PAGE

  • Functional characterization framework:

    Mutation TypeFunctional AssaysExpected Outcomes
    Active site residuesEnzyme activity assaysReduced catalytic efficiency (lower kcat)
    Substrate binding siteSubstrate binding affinity measurementsAltered Km values
    Membrane-interface residuesMembrane integration assaysChanged detergent solubility profiles
    Structural/folding residuesThermal stability assaysDecreased melting temperatures
  • In vivo complementation system:

    • Develop a complementation assay using lgt-deficient L. cholodnii (if viable) or E. coli

    • Express mutant variants and assess their ability to restore wild-type phenotypes

    • Measure lipoprotein processing efficiency through pulse-chase experiments

  • Advanced structural techniques:

    • For key functional variants, attempt experimental structure determination using X-ray crystallography or cryo-EM

    • Apply hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Use cross-linking mass spectrometry to identify residues in proximity in the folded protein

The interpretation of results should focus on identifying L. cholodnii-specific features that may relate to its unique filamentous lifestyle and sheath formation capabilities, while also recognizing the core conserved mechanisms shared with other bacterial Lgt enzymes .

How can researchers overcome difficulties in expressing and purifying functional L. cholodnii Lgt?

Membrane proteins like L. cholodnii Lgt present significant expression and purification challenges. The following methodological approaches can help overcome common obstacles:

  • Expression challenges and solutions:

    ChallengeSolution ApproachTechnical Details
    Toxicity during expressionUse tight expression controlApply glucose repression (0.5-1%) with pBAD vectors; use C41/C43(DE3) strains designed for toxic proteins
    Inclusion body formationLower induction temperatureGradually reduce temperature to 16-20°C post-induction; extend expression time to 16-24 hours
    Poor expression levelsOptimize codon usageAdapt codons to expression host; synthesize gene with optimized codons for rare tRNAs
    Protein misfoldingAdd folding enhancersSupplement with 5-10% glycerol, 0.5-1 M sorbitol, or 2.5-10 mM betaine
    DegradationInclude protease inhibitorsAdd complete protease inhibitor cocktail to lysis buffer; consider using protease-deficient strains
  • Solubilization optimization:

    • Screen multiple detergents systematically, beginning with mild options like DDM, LMNG, and digitonin

    • Test detergent concentrations from 1-5× CMC (critical micelle concentration)

    • Consider novel solubilization agents like SMA (styrene-maleic acid) copolymers that extract proteins with surrounding lipids

    • Implement step-wise solubilization protocols with increasing detergent concentrations

  • Purification strategy enhancement:

    • Design a two-tag purification approach (e.g., His-tag and FLAG or Strep-tag) for higher purity

    • Include additional chromatography steps (ion exchange, size exclusion) after initial affinity capture

    • Consider on-column detergent exchange during purification

    • Maintain critical lipids by adding them to purification buffers (e.g., phosphatidylglycerol at 0.01-0.05 mg/ml)

  • Activity preservation measures:

    • Monitor protein quality at each purification step using activity assays

    • Consider stabilizing additives in final buffers (glycerol 10-20%, specific lipids 0.1-0.5 mg/ml)

    • Test reconstitution into nanodiscs or proteoliposomes for long-term stability

    • Optimize storage conditions (temperature, buffer composition) through activity retention studies

  • Quality control checkpoints:

    • Verify membrane integration during expression using fractionation techniques

    • Confirm proper folding through thermal shift assays and circular dichroism

    • Assess oligomeric state using native PAGE or analytical ultracentrifugation

    • Validate functionality through activity assays compared to a benchmark (e.g., E. coli Lgt)

When troubleshooting persistent expression issues, consider constructing fusion proteins with well-expressed partners like MBP or SUMO, which can be later removed by specific proteases. For particularly challenging cases, cell-free expression systems incorporating lipid nanodiscs or detergent micelles may offer alternatives to traditional cell-based expression .

What strategies help resolve data inconsistencies when comparing L. cholodnii Lgt with homologs from other bacteria?

Resolving data inconsistencies when comparing L. cholodnii Lgt with homologs requires a systematic approach to identify and address variables that might influence experimental outcomes:

  • Standardization of experimental conditions:

    • Develop a core set of assay conditions that can be universally applied across Lgt homologs

    • Express all proteins in the same host system using identical tags and purification protocols

    • Prepare substrates (peptides, phospholipids) from the same source using consistent methods

    • Conduct parallel experiments with multiple homologs simultaneously to minimize batch effects

  • Addressing sequence and structural differences:

    Source of InconsistencyAnalytical ApproachResolution Strategy
    Sequence divergenceMultiple sequence alignmentMap divergent regions to structural elements; create chimeric proteins
    Substrate specificity differencesCross-substrate testingTest each Lgt with substrates from various species; determine specificity profiles
    Lipid environment requirementsSystematic lipid supplementationAdd defined lipid mixtures to purified proteins; reconstitute in controlled membranes
    Post-translational modificationsMass spectrometry analysisIdentify and characterize modifications; create modification-mimicking mutants
  • Normalization approaches for comparative analysis:

    • Calculate relative activity (percentage of maximum) rather than absolute values

    • Determine kinetic parameters (Km, kcat) for standardized comparison

    • Use internal controls (e.g., conserved substrates) to normalize between experiments

    • Apply statistical methods like Z-score normalization to account for batch effects

  • Advanced techniques for resolving mechanistic differences:

    • Hydrogen-deuterium exchange mass spectrometry to compare conformational dynamics

    • Cross-species complementation to assess functional equivalence in vivo

    • Biophysical techniques (ITC, SPR) to compare binding affinities under identical conditions

    • Molecular dynamics simulations to identify species-specific conformational behaviors

  • Systematic documentation of variables:

    • Create comprehensive metadata records for all experiments

    • Document buffer compositions, protein preparations, and experimental conditions in detail

    • Analyze environmental variables (temperature fluctuations, equipment differences)

    • Consider blind testing across different laboratories to validate key findings

When interpreting seemingly conflicting data, researchers should consider the biological context: L. cholodnii's filamentous nature and sheath-forming capabilities may necessitate functional adaptations in its Lgt that distinguish it from homologs in non-filamentous bacteria. These adaptations might manifest as apparent inconsistencies that actually reflect important biological differences related to the unique lifestyle of L. cholodnii .

How might understanding L. cholodnii Lgt contribute to biofilm control strategies?

The study of L. cholodnii Lgt offers several promising avenues for developing biofilm control strategies, particularly for managing filamentous bacterial growth in industrial and environmental settings:

  • Targeting Lgt function for filamentous growth inhibition:

    • Design specific inhibitors of L. cholodnii Lgt based on structural and mechanistic insights

    • Develop peptide-based competitive inhibitors that mimic the lipobox but cannot be processed

    • Create transition-state analogs that selectively bind the active site of Lgt

    • The advantage of this approach is specificity, as inhibitors can be designed to target unique features of L. cholodnii Lgt while minimizing effects on beneficial bacteria

  • Exploiting Lgt-lipoproteins relationship in sheath formation:

    • Identify Lgt-modified lipoproteins specifically involved in nanofibril production

    • Target downstream processes of sheath formation dependent on these lipoproteins

    • Design interventions that interfere with lipoprotein-mediated cell-cell communication in filaments

    • Focus particularly on lipoproteins involved in the directional control of filamentation (unilateral vs. bilateral elongation)

  • Environmental modulation approaches:

    • Identify environmental conditions that affect Lgt activity and optimize them to reduce biofilm formation

    • Develop surface modifications that interfere with Lgt-dependent adhesion mechanisms

    • Create controlled microenvironments that suppress filamentous growth based on insights from microfluidic experiments

  • Potential applications and research priorities:

    Application AreaResearch DirectionPredicted Impact
    Water distribution systemsLgt inhibitors as anti-biofouling agentsReduction in pipeline clogging and maintenance costs
    Wastewater treatmentControlled modulation of filamentous growthPrevention of bulking sludge issues while maintaining beneficial bacterial processes
    BioremediationEngineered L. cholodnii with modified Lgt functionEnhanced metal precipitation and recovery from contaminated waters
    BiosensorsLgt-dependent reporter systemsEarly detection of conditions favoring filamentous bacterial blooms
  • Integration with other control strategies:

    • Combine Lgt-targeted approaches with conventional biofilm management methods

    • Develop multi-target strategies addressing different aspects of filament formation

    • Create responsive systems that detect and intervene in early stages of filamentous growth

The development of such control strategies requires further research to understand the specific roles of Lgt-modified lipoproteins in L. cholodnii's unique filamentous growth pattern and sheath formation. Particular attention should be given to the relationship between Lgt function and the formation of nanofibrils, which are crucial for surface attachment and directional growth control. Understanding how nanofibrils affect the direction of filamentation (unilateral when they cap the cell pole, bilateral when surrounding the cell waist) will be key to developing precise intervention strategies .

What potential exists for applying genome editing techniques to study L. cholodnii Lgt in vivo?

The application of genome editing techniques to study L. cholodnii Lgt in vivo represents a frontier with significant research potential. Recent methodological advances offer promising approaches:

  • Adapting existing gene replacement methods:

    • Build upon the gene replacement method developed for L. cholodnii SP-6 by Kunoh et al.

    • Optimize the plasmid-based system (pUC18-mob) for targeting the lgt gene (Lcho_1492)

    • Implement the kanamycin resistance (Kmr) cassette strategy for selection of successful recombinants

    • Consider conditional expression systems if complete deletion proves lethal

  • CRISPR-Cas9 adaptation for L. cholodnii:

    • Design a CRISPR-Cas9 system optimized for L. cholodnii's filamentous nature

    • Develop specific delivery methods accounting for the sheath barrier

    • Create guide RNAs targeting lgt with minimal off-target effects

    • Establish protocols for homology-directed repair to introduce precise mutations

  • In vivo genome editing experimental design:

    Editing ApproachTechnical ConsiderationsExpected Outcomes
    Complete knockoutMay be lethal; use inducible systemsDetermination of essentiality in L. cholodnii context
    Point mutationsTarget conserved catalytic residuesStructure-function insights in native environment
    Domain swappingReplace domains with homologs from other bacteriaIdentification of species-specific functions
    Promoter modificationCreate expression gradientsCorrelation between Lgt levels and filament characteristics
    Fluorescent taggingC-terminal or internal tags preserving functionLocalization patterns during filament formation
  • Phenotypic analysis framework for edited strains:

    • Microscopic assessment of filament formation and sheath development

    • Nanofibril production quantification using specialized staining techniques

    • Cell chain integrity evaluation under various environmental conditions

    • Lipoprotein profiling through proteomics approaches

    • Surface attachment and biofilm formation capabilities

  • Integration with microfluidic technologies:

    • Utilize microfluidic devices as described by Kunoh et al. to track single-filament dynamics

    • Compare wild-type and genetically modified strains under identical controlled conditions

    • Analyze responses to environmental perturbations in real-time

    • Quantify parameters like elongation rate, bending force, and collision response behavior

The most promising approach may involve creating a library of L. cholodnii strains with various modifications to lgt, ranging from point mutations in catalytic residues to domain replacements. This would allow for systematic characterization of structure-function relationships in the native cellular context. The recent development of gene replacement methods specifically for L. cholodnii SP-6 provides a crucial foundation for these advanced genetic manipulation strategies .

Special attention should be given to the potential connection between Lgt function and the unique characteristics of L. cholodnii, such as its ability to form filaments encased in sheaths composed of nanofibrils. Understanding this relationship could provide insights into bacterial filament formation mechanisms with broader implications for managing filamentous bacteria in various environmental and industrial contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.