Recombinant Lepus europaeus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant MT-ND4L

The Lepus europaeus MT-ND4L is a recombinant protein expressed in E. coli with an N-terminal His-tag (6xHis) for purification and detection . This hydrophobic transmembrane protein (98 amino acids) represents a core subunit of mitochondrial Complex I, responsible for electron transfer from NADH to ubiquinone . Its gene (MT-ND4L) overlaps with MT-ND4 in mitochondrial DNA, a unique feature enabling efficient transcription . The recombinant form is optimized for biochemical assays, structural studies, and disease modeling .

Functional Role in Complex I

MT-ND4L is part of the minimal assembly required for NADH dehydrogenase activity . It participates in:

  1. Electron Transfer: Facilitates NADH-to-ubiquinone electron transport via iron-sulfur clusters and flavin mononucleotide (FMN) .

  2. Proton Pumping: Conformational changes during electron transfer drive H⁺ efflux, contributing to ATP synthesis .

  3. Stability: Forms hydrophobic core of Complex I, anchoring peripheral subunits .

Expression and Refinement

ParameterDetailSource
Host SystemE. coli (BL21(DE3) or similar strains)
TagN-terminal 6xHis tag for affinity chromatography
Purity>90% (SDS-PAGE validated)
ContaminantsHost proteins/peptidoglycan (mitigated via optimized lysis)

Key Challenges

  • Proper Folding: Hydrophobic nature necessitates denaturation/renaturation steps or detergents for solubility .

  • Stability: Susceptible to oxidation and aggregation; requires 50% glycerol for storage .

Optimal Conditions

ParameterDetailSource
Storage-20°C/-80°C (aliquoted; avoid freeze-thaw cycles)
BufferTris/PBS-based with 6% trehalose or 50% glycerol, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL); add 5–50% glycerol for long-term stability

Experimental Uses

  1. Complex I Assembly Studies:

    • Reconstitution with other subunits (e.g., ND1, ND2) to model mitochondrial disorders .

  2. ELISA and Antibody Development:

    • Used as antigen in ELISA kits for quantifying MT-ND4L in biological samples .

  3. Disease Modeling:

    • Mutant forms (e.g., Val65Ala) linked to Leber’s Hereditary Optic Neuropathy (LHON) can be engineered to study optic nerve degeneration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Lepus europaeus (European hare)
Target Names
Target Protein Sequence
MPSIYVNIFLAFIFALLGMLIYRSHLMSSLLCLEGMMLSLFILITLTALNMHFTLSFMFP IVLLVFAACEAAIGLALLVMVSNTYGMDYVQNLNLLQC
Uniprot No.

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as the electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its role in mitochondrial function?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a gene of the mitochondrial genome that codes for NADH-ubiquinone oxidoreductase chain 4L protein. This protein is a subunit of NADH dehydrogenase (ubiquinone), also known as Complex I, which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain .

Functionally, the MT-ND4L protein participates in the first step of the electron transport process during oxidative phosphorylation, specifically in the transfer of electrons from NADH to ubiquinone. This process creates an electrochemical gradient across the inner mitochondrial membrane, which is essential for ATP production, the cell's primary energy source .

How does recombinant MT-ND4L differ from native MT-ND4L?

Recombinant MT-ND4L is typically produced in expression systems such as E. coli, often with affinity tags (like His-tags) to facilitate purification. While the primary amino acid sequence remains identical to the native protein, several key differences exist:

FeatureNative MT-ND4LRecombinant MT-ND4L
SourceMitochondrial inner membraneExpression system (e.g., E. coli)
Post-translational modificationsPresent as in vivoMay be absent or different
Structural contextEmbedded within Complex IIsolated protein or in artificial membrane
Affinity tagsAbsentOften present (e.g., His-tag)
StabilityStabilized by Complex I interactionsMay require special buffer conditions

When working with recombinant MT-ND4L, researchers should consider these differences, particularly when interpreting functional assays or structural studies .

What are the optimal conditions for handling and storing recombinant MT-ND4L protein?

For optimal handling of recombinant MT-ND4L:

  • Storage: Store at -20°C or -80°C for extended storage

  • Working aliquots: Maintain at 4°C for up to one week

  • Buffer composition: Use Tris-based buffer with 50% glycerol optimized for protein stability

  • Avoid: Repeated freeze-thaw cycles which compromise protein integrity

  • Reconstitution: For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Glycerol addition: Add 5-50% glycerol (final concentration) and aliquot for long-term storage

When preparing working solutions, briefly centrifuge vials prior to opening to bring contents to the bottom of the tube .

What expression systems are most effective for producing recombinant MT-ND4L?

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coliHigh yield, cost-effectiveLacks post-translational modificationsMay require codon optimization
Yeast systemsBetter folding of membrane proteinsLower yields than E. coliCan incorporate some PTMs
Insect cellsGood for eukaryotic proteinsMore expensive, slowerBetter for complex proteins
Mammalian cellsMost authentic PTMsHighest cost, lowest yieldBest for functional studies

For MT-ND4L specifically, researchers should consider using bacterial strains optimized for membrane protein expression (like C41/C43) and include detergents or lipid nanodiscs to stabilize the hydrophobic regions of the protein .

What methods are most effective for assessing the purity and integrity of recombinant MT-ND4L preparations?

Multiple complementary methods should be employed:

  • SDS-PAGE: Verify protein size and assess purity (>90% purity is generally considered acceptable)

  • Western blotting: Confirm identity using antibodies against MT-ND4L or affinity tags

  • Mass spectrometry: Verify molecular weight and sequence integrity

  • Circular dichroism: Assess secondary structure, particularly important for membrane proteins

  • Activity assays: Measure electron transfer capability within reconstituted systems

  • Dynamic light scattering: Evaluate homogeneity and detect aggregation

For membrane proteins like MT-ND4L, additional consideration should be given to the detergent environment and lipid composition when assessing functional integrity .

How do mutations in MT-ND4L contribute to Leber hereditary optic neuropathy (LHON)?

A mutation in MT-ND4L (T10663C or Val65Ala) has been identified in several families with Leber hereditary optic neuropathy (LHON). This mutation changes a single amino acid in the protein, replacing valine with alanine at position 65 .

The mechanisms by which this mutation leads to LHON include:

  • Disruption of Complex I assembly or stability

  • Reduced electron transport efficiency

  • Increased production of reactive oxygen species (ROS)

  • Compromised ATP production in retinal ganglion cells

  • Potential interaction with environmental factors and nuclear genetic modifiers

Research methodologies to investigate these mechanisms include:

  • Cybrid cell studies to isolate the effect of mitochondrial mutations

  • Oxygen consumption and ATP production measurements

  • ROS detection assays

  • Blue native PAGE to assess Complex I assembly

  • Animal models expressing the mutation

What is the significance of concurrent mutations in MT-ND4L and how can their synergistic effects be studied?

Concurrent mutations in MT-ND4L, such as the 10609T>C and 10663T>C mutations identified in an Arab pedigree, may have synergistic effects on mitochondrial function. These mutations result in non-conservative amino acid changes (Ile47Thr and Val65Ala) in the encoded ND4L protein .

To study these synergistic effects, researchers should:

  • Create single and double mutants using site-directed mutagenesis

  • Perform comparative functional assays between wild-type, single mutants, and double mutants

  • Use molecular dynamics simulations to predict structural changes

  • Employ biochemical assays to measure electron transport efficiency

  • Assess ROS production and mitochondrial membrane potential

  • Conduct pedigree analysis to track co-inheritance patterns

The presence of multiple mutations within a single mitochondrial gene suggests potential epistatic interactions that may exacerbate phenotypes or create novel disease mechanisms .

How is MT-ND4L associated with Alzheimer's disease, and what methodologies are most appropriate for investigating this connection?

Recent evidence from the Alzheimer's Disease Sequencing Project (ADSP) reveals a study-wide significant association between Alzheimer's disease (AD) and a rare MT-ND4L variant (rs28709356 C>T; MAF = 0.002; P = 7.3 × 10^-5). Gene-based tests also showed significant association with MT-ND4L (P = 6.71 × 10^-5) .

To investigate this connection, researchers should consider:

  • Whole exome sequencing with specific pipelines for accurate assembly and variant calling in mitochondrial genomes

  • Association studies using statistical tests like SCORE and SKAT-O

  • Expression studies comparing MT-ND4L levels in AD cases vs. controls

  • Functional assays to assess the impact of AD-associated variants on:

    • Complex I assembly and activity

    • ROS production

    • Neuronal bioenergetics

    • Synaptic function

  • Integration of mitochondrial data with nuclear genetic risk factors

This research highlights the importance of considering both mitochondrial variants and nuclear genes related to mitochondrial function (such as TAMM41) when investigating AD pathogenesis .

How can phylogenetic analysis of MT-ND4L inform studies of evolutionary relationships among species?

MT-ND4L sequences can be valuable for phylogenetic analyses due to their relatively conserved nature across species. Researchers investigating evolutionary relationships should:

  • Obtain MT-ND4L sequences from multiple species of interest

  • Align sequences using appropriate tools (e.g., Clustal, MUSCLE)

  • Construct phylogenetic trees using methods such as:

    • UPGMA (Unweighted Pair Group Method with Arithmetic Mean)

    • Maximum Likelihood

    • Bayesian inference

  • Assess genetic distances between species

  • Identify conserved versus variable regions that may reflect evolutionary pressures

For example, phylogenetic analysis of MT-ND4L in Khorasan native chickens revealed close relationships with other Asian chicken breeds like Jiangbian, Lvenwu, and Red jungle fowl, with the lowest genetic distance observed between these groups .

What are the key differences in MT-ND4L structure and function between mammalian species, and how might these inform cross-species research?

When comparing MT-ND4L across mammalian species such as humans, European hare (Lepus europaeus), and domestic dogs (Canis lupus), several differences and similarities emerge:

FeatureHuman MT-ND4LLepus europaeus MT-ND4LCanis lupus MT-ND4L
Length98 amino acids98 amino acids98 amino acids
Key conserved regionsTransmembrane domainsTransmembrane domainsTransmembrane domains
Variable regionsLoop regionsLoop regionsLoop regions
Disease-associated sitesVal65 (LHON)Corresponding residues may differCorresponding residues may differ

Understanding these differences is crucial for:

  • Selecting appropriate animal models for disease studies

  • Interpreting results from cross-species experiments

  • Designing species-specific antibodies or inhibitors

  • Identifying functionally critical versus adaptable protein regions

Researchers should conduct careful sequence alignment and homology modeling before extrapolating findings between species .

What techniques are most effective for studying the interaction between MT-ND4L and other subunits of Complex I?

Investigating interactions between MT-ND4L and other Complex I subunits requires specialized techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Provides high-resolution structural information

    • Can capture different conformational states

    • Allows visualization of subunit interfaces

  • Crosslinking mass spectrometry (XL-MS):

    • Identifies specific amino acid contacts between subunits

    • Can detect transient interactions

    • Complementary to cryo-EM data

  • FRET (Förster Resonance Energy Transfer):

    • Measures distances between labeled subunits

    • Can be performed in living cells

    • Detects conformational changes during catalysis

  • Co-immunoprecipitation with specific antibodies:

    • Identifies stable protein-protein interactions

    • Can be coupled with mass spectrometry for identification

  • Genetic approaches:

    • Site-directed mutagenesis to disrupt specific interfaces

    • Suppressor mutation analysis to identify compensatory changes

These methods can reveal how mutations in MT-ND4L affect its integration into Complex I and subsequent functional consequences .

How can recombinant MT-ND4L be used to develop therapeutic approaches for mitochondrial diseases?

Recombinant MT-ND4L offers several potential therapeutic applications for mitochondrial diseases:

  • Gene therapy approaches:

    • Use of AAV (adeno-associated virus) vectors for delivery of wild-type MT-ND4L

    • Development of allotopic expression systems (expressing mitochondrial genes from the nucleus)

    • CRISPR-based mitochondrial DNA editing techniques

  • Drug development:

    • High-throughput screening platforms using recombinant MT-ND4L

    • Structure-based drug design targeting specific mutations

    • Identification of compounds that stabilize mutant MT-ND4L function

  • Biomarker development:

    • Generation of antibodies against wild-type and mutant MT-ND4L forms

    • Monitoring therapy effectiveness through conformational antibodies

  • Protein replacement strategies:

    • Development of cell-penetrating peptide tags for MT-ND4L delivery

    • Liposome-based delivery systems for membrane proteins

These approaches require careful consideration of the unique challenges associated with targeting mitochondrial proteins, including double membrane penetration and proper protein folding and integration .

What are the most promising experimental models for studying MT-ND4L mutations and their phenotypic consequences?

Several experimental models offer unique advantages for studying MT-ND4L mutations:

Model SystemAdvantagesLimitationsBest Applications
Transmitochondrial cybrid cellsIsolate mtDNA effectsLimited to cell typesBiochemical studies, drug screening
Drosophila modelsFast generation time, genetic toolsEvolutionary distance from mammalsHigh-throughput genetic studies
Mouse modelsMammalian physiologyDifficulty introducing mtDNA mutationsIn vivo pathophysiology
Patient-derived iPSCsHuman genetic backgroundVariability between linesDisease modeling, personalized medicine
YeastEasily manipulated mtDNAEvolutionary distanceBasic functional studies

For comprehensive investigation of MT-ND4L mutations, researchers should:

  • Begin with biochemical characterization in cybrid cells

  • Confirm findings in patient-derived tissues when available

  • Develop animal models for in vivo studies

  • Use multiple models to validate findings across systems

Each model system provides complementary insights into mutation effects across different biological contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.