Recombinant Lepus othus Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lepus othus Cytochrome b (MT-CYB)

Recombinant Lepus othus Cytochrome b (MT-CYB) is a protein encoded by the mitochondrial genome of Lepus othus, commonly known as the Alaskan hare. This protein belongs to the cytochrome b family, which is universally present in the mitochondria of eukaryotic organisms. The recombinant form refers to the artificially produced version of this protein, synthesized using genetic engineering techniques for research and commercial purposes. The gene that encodes this protein is designated as MT-CYB, with alternative designations including COB, CYTB, and MTCYB .

Cytochrome b from Lepus othus serves as a critical component of the electron transport chain in mitochondria, specifically functioning as part of Complex III (also known as the cytochrome bc1 complex). This complex plays an essential role in cellular respiration by facilitating the transfer of electrons from ubiquinol to cytochrome c, coupled with the translocation of protons across the inner mitochondrial membrane, ultimately contributing to adenosine triphosphate production .

In its recombinant form, Lepus othus Cytochrome b is typically produced with specific characteristics suited for research applications. According to commercial specifications, it is available in quantities such as 50 μg and is supplied in a Tris-based buffer with 50% glycerol for stability. The protein requires storage at -20°C, or at -80°C for extended preservation, with recommendations against repeated freezing and thawing cycles to maintain its structural integrity and functional properties .

Table 2: Domain Organization of Lepus othus Cytochrome b

Domain TypeNumber
Transmembrane regions8
Cytoplasmic regions5
Extracellular regions4

The transmembrane helices play a particularly important role in the protein's function, with specific amino acid residues involved in proton translocation channels. For instance, position 194 of Cytochrome b has been identified as a site lining these channels, while position 23 is involved in interactions between subunits of the respiratory complex . These structural features are highly conserved across species, reflecting the fundamental importance of this protein in cellular energy metabolism.

Function and Role in Mitochondrial Processes

Recombinant Lepus othus Cytochrome b functions as an integral component of the oxidative phosphorylation pathway in mitochondria. This pathway is the primary mechanism for cellular adenosine triphosphate production, making it essential for energy metabolism in all eukaryotic cells. As part of Complex III in the electron transport chain, Cytochrome b facilitates the transfer of electrons while simultaneously contributing to the generation of a proton gradient across the inner mitochondrial membrane .

The protein specifically participates in the Q cycle, where it helps oxidize ubiquinol to ubiquinone while transferring electrons to cytochrome c. This process is coupled with the translocation of protons from the mitochondrial matrix to the intermembrane space, contributing to the electrochemical gradient that drives adenosine triphosphate synthesis. The transmembrane domains of Cytochrome b, with their specific arrangements of alpha helices, form channels that facilitate this proton movement, highlighting the direct relationship between structure and function in this protein .

The functional significance of Cytochrome b extends beyond basic energy production. Studies on mitochondrial genes, including Cytochrome b, have revealed evidence of positive selection in response to environmental adaptations. In the genus Lepus, which includes the Alaskan hare, such adaptive changes in mitochondrial oxidative phosphorylation genes have been associated with climatic variation and potential responses to different environmental conditions, suggesting a role in ecological adaptation .

Table 3: Key Properties of Recombinant Lepus othus Cytochrome b

PropertyDescription
Uniprot IdentifierO47556
Gene NameMT-CYB (synonyms: COB, CYTB, MTCYB)
Sequence Identity with Bovine Counterpart85.98%
Global Model Quality Estimate0.98
Storage Conditions-20°C, or -80°C for extended storage
Buffer CompositionTris-based buffer with 50% glycerol

Evolutionary Significance of Cytochrome b in Lepus Species

The Cytochrome b gene has proven invaluable in evolutionary biology studies, particularly for understanding the phylogenetic relationships among closely related species. In the context of Lepus othus and other hares, this gene has provided significant insights into their evolutionary history and taxonomic classification, making it a crucial molecular marker for systematic studies of leporids.

Research analyzing a 702-base pair region of the mitochondrial Cytochrome b gene across various Lepus species has revealed important phylogenetic patterns. These studies have consistently identified two species groups: a western American clade and an arctic clade (which includes Lepus townsendii). Notably, the data suggest that the three arctic species of hares—Lepus arcticus, Lepus timidus, and Lepus othus—may potentially represent a single species rather than distinct taxonomic entities, challenging current taxonomic classifications .

The Cytochrome b gene exhibits considerable variability, making it particularly useful for phylogenetic analyses at the species and genus levels. Studies have quantified this variability in detail, providing a statistical basis for its utility in evolutionary studies.

Table 4: Cytochrome b Sequence Variability in Phylogenetic Studies

CharacteristicValue
Aligned Positions702
Variable Positions219 (31.2%)
Parsimony Informative Positions153 (21.8%)

This level of genetic variation makes Cytochrome b a useful marker for reconstructing evolutionary relationships, although challenges such as substitutional saturation have been noted when analyzing more distantly related taxa . The high percentage of variable positions indicates substantial evolutionary divergence within the genus Lepus, allowing researchers to infer relationships between species and populations.

Evolutionary analyses of Cytochrome b have also revealed instances of positive selection on specific amino acid residues, suggesting adaptive evolution in response to environmental pressures. Within the genus Lepus, such selection has been linked to adaptation to different climatic conditions, illustrating the role of this gene in environmental adaptation processes and suggesting it may be more than just a neutral marker of evolutionary history .

Applications and Research Involving Recombinant Lepus othus Cytochrome b

Recombinant Lepus othus Cytochrome b has various applications in scientific research, particularly in fields such as molecular biology, evolutionary studies, and biotechnology. One primary application is in enzyme-linked immunosorbent assays, where the recombinant protein can be used to detect and measure antibodies or antigens in biological samples, providing a valuable tool for immunological research and diagnostics .

In phylogenetic studies, Cytochrome b sequences from Lepus othus and other species have been instrumental in reconstructing evolutionary relationships and resolving taxonomic uncertainties. These analyses employ various methods, including parsimony, neighbor-joining, and maximum likelihood approaches, to generate phylogenetic trees that represent evolutionary histories. The extensive use of Cytochrome b in such studies underscores its value as a molecular marker for evolutionary analysis .

Protein structure modeling represents another important research application. By generating homology models of Lepus othus Cytochrome b and comparing them with known structures from related species, researchers can gain insights into the structural determinants of protein function and identify sites of functional significance. These studies have revealed important aspects of the protein's three-dimensional structure and how it relates to its function in the electron transport chain .

Studies on the effects of amino acid substitutions on protein function and stability have also employed recombinant Cytochrome b proteins. These investigations help identify how specific mutations might affect protein performance under different conditions, providing insights into adaptive evolution processes. Such research has implications not only for understanding the evolution of hares but also for broader questions about mitochondrial adaptation to environmental challenges .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly include it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for accurate delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Lepus othus (Alaskan hare)
Target Names
Target Protein Sequence
MTNIRKTHPLLKIVNHSLIDLPAPSNISAWWNFGSLLGLCLMIQILTGLFLAMHYTSDTA TAFSSVTHICRDVNYGWLIRYLHANGASMFFICLYMHVGRGIYYGSYTYLETWNIGIILL FAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFA FHFILPFIIAALVMIHLLFLHETGSNNPSGIPSDSDKIPFHPYYTIKDLLGFLV
Uniprot No.

Target Background

Function
Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently utilized for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Lepus othus Cytochrome b?

For optimal preservation of functional integrity, Recombinant Lepus othus Cytochrome b should be stored according to the following guidelines:

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week

  • Standard storage: -20°C in Tris-based buffer with 50% glycerol

  • Long-term storage: -80°C is recommended for extended preservation

  • Important note: Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein degradation and loss of functional activity

The storage buffer is typically optimized specifically for this protein, consisting of Tris-based buffer with 50% glycerol. This formulation helps maintain protein stability by preventing denaturation and protecting against proteolytic degradation.

How can I verify the identity and purity of Recombinant Lepus othus Cytochrome b?

Verification of recombinant Lepus othus Cytochrome b can be accomplished through multiple complementary approaches:

  • SDS-PAGE analysis: Verify the molecular weight (should match the expected ~44 kDa with potential variation based on tag type)

  • Western blot: Using antibodies specific to cytochrome b or to the protein tag

  • Mass spectrometry: For precise molecular weight determination and sequence verification

  • Spectrophotometric analysis: Cytochrome b has characteristic absorption peaks when in reduced form

  • Functional assay: Measuring cytochrome c reductase activity using methods similar to those described for yeast mitochondria:

    • Prepare reaction mixture containing cytochrome c

    • Add recombinant cytochrome b

    • Measure reduction of cytochrome c spectrophotometrically

What are effective methods for amplifying Lepus othus cytochrome b gene for research purposes?

The amplification of Lepus othus cytochrome b can be achieved through several established methodological approaches:

Whole Gene Amplification:

  • Long-range PCR using Phusion Flash High-Fidelity PCR Master Mix can amplify the complete mitochondrial gene

  • This approach minimizes the risk of amplifying nuclear copies of mitochondrial sequences (NUMTs)

Partial Gene Amplification:

  • For targeted studies, primers can be designed to amplify specific regions

  • A useful approach involves primers that amplify a 365-bp fragment including the 3' end of mitochondrial cytochrome b, as demonstrated in sand fly studies

Cross-Species Primer Design:
When designing primers for Lepus othus, researchers can utilize consensus sequences from related species. The primers should:

  • Target conserved regions flanking variable segments

  • Have compatible melting temperatures

  • Avoid regions with high secondary structure potential

  • Include at least one primer that targets a region unique to mitochondrial cytochrome b to avoid NUMT amplification

After amplification, verification can be performed through gel electrophoresis, with expected band sizes based on the primer design and target region.

How can I detect nucleotide variations in cytochrome b sequences effectively?

Several techniques can be employed to detect nucleotide variations in cytochrome b sequences, each with different advantages depending on research needs:

Single Strand Conformation Polymorphism (SSCP):

  • Efficient for screening large numbers of specimens

  • Can detect single nucleotide differences

  • Procedure:

    • PCR amplify the target region

    • Denature PCR products to obtain single-stranded DNA

    • Run on non-denaturing polyacrylamide gel

    • Identify unique conformations by their differential mobility patterns

    • Sequence samples with different SSCP patterns to confirm variants

Direct Sequencing:

  • Gold standard for identifying specific nucleotide changes

  • Can be performed using Sanger sequencing for targeted regions or next-generation sequencing for whole gene/genome approaches

  • For complete mtDNA sequencing, a combination of long-range PCR and either:

    • Sanger sequencing with nested primers, or

    • Next-generation sequencing (e.g., 454 technology)

PCR-RFLP (Restriction Fragment Length Polymorphism):

  • Useful for identifying known variants

  • Example application: distinguishing between native and introgressed mtDNA in Lepus species

Next-Generation Sequencing Quality Control Parameters:
When using NGS technologies, apply these quality filters:

  • Phred quality score > 20

  • Coverage > 10×

  • Validate critical regions using Sanger sequencing

What approaches can be used to study the function of cytochrome b variants?

Functional studies of cytochrome b variants can be conducted using several complementary approaches:

Yeast Model System:

  • Create plasmids carrying wild-type or mutated cytochrome b sequences

  • Perform mitochondrial transformation using biolistic methods

  • Verify homoplasmy (containing only one mtDNA population)

  • Prepare mitochondria for functional assays

  • Measure cytochrome c reductase activity

  • Determine impact on growth in different conditions

Inhibitor Titration Studies:

  • Measure cytochrome c reduction activity in the presence of increasing concentrations of inhibitors

  • Determine IC50 values (midpoint inhibition concentrations)

  • Normalize IC50 values by the concentration of complex III

  • Compare IC50 values between wild-type and variant forms to identify differences in drug sensitivity

Respiratory Growth Assays:

  • Grow yeast strains in medium with increasing drug concentrations

  • Inoculate from 1-day-old cultures to an OD600nm of 0.2

  • Incubate at 28°C with vigorous shaking

  • Measure cell densities (OD600nm) after 2-3 days

  • Compare growth curves between wild-type and variant strains

This approach has successfully demonstrated that variants like m.15257G>A (p.Asp171Asn) can increase sensitivity to atovaquone, while m.14798T>C (p.Phe18Leu) can enhance sensitivity to clomipramine .

How can I construct a phylogenetic framework using cytochrome b sequences from Lepus species?

Constructing a robust phylogenetic framework using cytochrome b sequences requires careful consideration of methodological approaches. Based on studies of Lepus species, the following comprehensive methodology is recommended:

Sequence Acquisition and Processing:

  • Extract DNA from appropriate tissue samples (blood, skin, or frozen tissue)

  • Amplify cytochrome b using established primers (typically targeting 400-700bp regions)

  • Sequence PCR products using bidirectional Sanger sequencing or NGS approaches

  • Clean and align sequences using software like MAFFT or MUSCLE

Phylogenetic Reconstruction Methods:
Multiple analytical approaches should be employed and compared:

  • Parsimony analysis: Identifies the tree requiring the fewest evolutionary changes

  • Neighbor-joining: Distance-based method with computational efficiency

  • Maximum likelihood: Statistical approach evaluating the probability of sequence evolution under specific models

  • Bayesian inference: Provides posterior probabilities for tree topologies

Addressing Saturation Issues:
Substitutional saturation can hinder phylogenetic analyses, particularly when including distant outgroups. Strategies include:

  • Analyzing both rooted and unrooted trees

  • Examining variation in tree topologies between different reconstruction methods

  • Considering separately synonymous and nonsynonymous substitutions

Software Tools for Analysis:

  • MEGA for basic alignment and tree-building

  • MrBayes for Bayesian phylogenetic inference

  • RAxML or IQ-TREE for maximum likelihood analyses

  • FigTree or iTOL for tree visualization and annotation

The application of these methods to Lepus species has revealed important insights, including the finding that North American species of Lepus do not form a monophyletic entity, suggesting complex evolutionary histories .

What methods can detect natural selection in cytochrome b sequences across species?

Detection of natural selection in cytochrome b sequences requires sophisticated analytical approaches that examine the ratio of nonsynonymous to synonymous substitutions (dN/dS or ω). The following comprehensive methodology has been successfully applied to Lepus species:

Sequence Preparation:

  • Align complete protein-coding sequences

  • Construct a robust phylogenetic tree using methods described in FAQ 3.1

  • Prepare multiple analyses:

    • All 13 protein-coding mitochondrial genes concatenated

    • Genes concatenated by respiratory complex

    • Individual gene analyses

Site-Based Selection Tests:

  • PAML site models: Compare models that allow or disallow positive selection

  • DATAMONKEY server tools:

    • SLAC (Single Likelihood Ancestor Counting): Calculates dN and dS at each site

    • FEL (Fixed Effects Likelihood): Site-by-site selection without assumptions about rate distributions

    • REL (Random Effects Likelihood): Uses Bayesian approaches to infer selection at each site

Branch-Based Selection Tests:

  • Branch models in PAML: Allow ω to vary along branches

  • GA-branch model: Determines which combinations of rates per branches best fit the data

  • Test specific hypotheses about selection regimes (e.g., arctic lineages versus temperate lineages)

Branch-Site Tests:

  • More powerful for detecting episodic selection

  • Focus on particular residues along specific lineages

  • Compare models in which site classes in foreground lineages are allowed values >1 against null models

Statistical Testing:

  • Use Likelihood Ratio Tests (LRT) to compare nested models

  • Apply Bayes Factors for comparing non-nested models

  • Correct for multiple testing when performing many tests

These methods have revealed evidence of adaptive evolution in mitochondrial genes of species living in extreme environments, providing insight into the molecular basis of thermal adaptation .

How can I analyze the functional impact of specific amino acid substitutions in cytochrome b?

Analyzing the functional impact of specific amino acid substitutions in cytochrome b requires an integrated approach combining structural analysis, in vitro biochemistry, and computational prediction:

Structural Analysis Approach:

  • Map substitutions onto the 3D structure of cytochrome b

  • Determine proximity to functional sites:

    • Ubiquinol binding sites (Qo and Qi)

    • Heme binding regions

    • Transmembrane domains

    • Protein-protein interaction interfaces

Functional DomainRole in Cytochrome bExample Mutations with Known Effects
Qo siteUbiquinol oxidationm.15257G>A (p.Asp171Asn): Increased atovaquone sensitivity
Qi siteUbiquinone reductionm.14798T>C (p.Phe18Leu): Enhanced clomipramine sensitivity
Transmembrane helicesStructural integrityVarious mutations can affect protein folding and stability
Heme-binding domainsElectron transportMutations can alter redox potential

Biochemical Characterization:

  • Generate the variant protein using site-directed mutagenesis

  • Express in a suitable system (yeast model recommended)

  • Isolate mitochondria and measure:

    • Complex III activity

    • ROS production

    • Drug sensitivity profiles

    • Growth rates under various conditions

Computational Prediction Tools:

  • PROVEAN, SIFT, or PolyPhen-2: Predict functional impact of amino acid substitutions

  • MutPred: Predicts molecular mechanisms of disease

  • FoldX: Calculates changes in protein stability upon mutation

Evolutionary Conservation Analysis:

  • Analyze conservation scores across species

  • Determine if substitutions occur in conserved regions

  • Consider if variants are found in species adapted to specific environments (e.g., arctic species)

By integrating these approaches, researchers have shown that seemingly "silent" mutations in cytochrome b can significantly modify the properties of complex III, suggesting they may play important roles in adaptation to different environments and potentially in human disease .

What is the significance of introgressed cytochrome b haplotypes in Lepus species and how can they be detected?

Introgressed cytochrome b haplotypes in Lepus species represent important genetic evidence of historical hybridization events that can provide insights into species boundaries, adaptation processes, and evolutionary history.

Significance of Introgression:

  • Reveals historical and ongoing gene flow between species

  • May indicate adaptive introgression if specific haplotypes are selectively advantageous

  • Complicates phylogenetic reconstruction and species delimitation

  • Provides natural experiments for studying the functional consequences of different cytochrome b variants

Detection Methodologies:

PCR-RFLP Assays:

  • Design restriction enzyme digestion protocols that differentiate between species-specific variants

  • Amplify cytochrome b gene region

  • Digest with appropriate restriction enzymes

  • Analyze fragment patterns to identify source species

Direct Sequencing and Phylogenetic Analysis:

  • Sequence cytochrome b from multiple individuals per species

  • Construct phylogenetic trees

  • Identify individuals whose haplotypes cluster with different species

  • Look for discordance between mitochondrial and nuclear phylogenies

Population Genetic Analyses:

  • Calculate nucleotide diversity within populations

  • Perform tests for historical demographic changes (e.g., Fu's Fs statistic, growth rate estimation)

  • Compare genetic diversity patterns between native and introgressed haplotypes

Examples from Research:
Studies have documented introgression of L. timidus mtDNA into other species including L. granatensis, L. corsicanus, and possibly L. townsendii. In the case of L. granatensis, specimens can harbor either native L. granatensis or introgressed L. timidus mtDNA .

Analytical Considerations:

  • Incorporate nuclear markers to confirm introgression versus incomplete lineage sorting

  • Consider demographic history when interpreting patterns

  • Examine geographical distribution of introgressed haplotypes

  • Test for evidence of selection on introgressed variants

Understanding these patterns has revealed that species like Lepus othus, L. arcticus, and L. timidus share close evolutionary relationships despite their current geographic distributions across Alaska, northern Canada, and northern Eurasia respectively .

How can Single Strand Conformation Polymorphism (SSCP) be optimized for cytochrome b haplotype detection?

Single Strand Conformation Polymorphism (SSCP) is a valuable technique for efficiently screening large numbers of samples for cytochrome b sequence variations before committing resources to full sequencing. Optimization of this technique involves several key parameters:

Protocol Optimization:

  • Fragment Size Selection: Target fragments of 300-400bp for optimal sensitivity

    • For cytochrome b, primers can be designed to amplify a 365-bp fragment including the 3' end as demonstrated in Lutzomyia studies

  • Gel Composition Optimization:

    • Polyacrylamide concentration: Test 8-12% range

    • Crosslinker ratio: Adjust bis-acrylamide proportion

    • Addition of glycerol (5-10%) can enhance sensitivity

  • Electrophoresis Conditions:

    • Temperature: Run at 4°C for maximum sensitivity

    • Voltage: Lower voltages (150-200V) improve resolution

    • Running time: Extend to allow maximal separation

  • Visualization Methods:

    • Silver staining for highest sensitivity

    • SYBR Green or GelRed for rapid detection

    • Radioactive labeling for maximum sensitivity when appropriate

Verification Process:

  • Establish control samples with known sequence differences

  • Run side-by-side with test samples

  • Select representatives of each SSCP pattern for sequencing

  • Confirm correlation between SSCP mobility and sequence variation

Advantages Demonstrated in Research:

  • Detection of single nucleotide differences between haplotypes

  • Consistent mobility patterns for identical sequences

  • Reduced time and cost compared to sequencing all samples

  • Ability to detect mixed infections or heteroplasmy

Using this approach, researchers can rapidly screen large sample sets and select specific specimens for detailed sequence analysis, greatly enhancing the efficiency of population genetic and phylogenetic studies of cytochrome b variation.

What statistical approaches should be used to analyze cytochrome b sequence data in population studies?

Population genetic analyses of cytochrome b sequence data require robust statistical approaches to extract meaningful evolutionary insights. The following methodologies have proven effective in studies of Lepus species:

Diversity Measurements:

  • Nucleotide Diversity (π): Calculate with confidence intervals

    • Example from studies: L. arcticus showed π = 0.0228 (95% CI: 0.0111–0.0345)

    • L. othus showed lower diversity with π = 0.0050 (95% CI: 0.0019–0.0081)

    • L. timidus showed higher diversity with π = 0.0617 (95% CI: 0.0304–0.0920)

  • Haplotype Diversity: Measure using standard formulas in software like DnaSP

Demographic History Analysis:

  • Growth Rate Estimation:

    • Use software like FLUCTUATE or LAMARC

    • Example: L. timidus showed significant positive growth rate of 33.3 (99.9% CI: 23.1–43.4)

  • Neutrality Tests:

    • Fu's Fs statistic: Detects population expansion

      • Example: L. timidus had significant Fs value of -11.4203 (P = 0.01)

    • Tajima's D: Tests deviation from neutral evolution

Phylogeographic Analysis:

  • Network Analysis:

    • Construct median-joining networks to visualize relationships

    • Identify star-like patterns indicative of population expansion

  • AMOVA (Analysis of Molecular Variance):

    • Partition genetic variation within and among populations

    • Test hierarchical population structure

Testing Analytical Assumptions:

  • Compare results from different software packages

  • Assess impact of migration using LAMARC

  • Compare outcomes with and without outgroups

Recommended Software Tools:

  • Arlequin for basic population genetic analysis

  • DnaSP for diversity calculations and neutrality tests

  • Network for median-joining network construction

  • BEAST for Bayesian demographic reconstruction

These approaches can reveal important patterns such as historical population expansions, bottlenecks, and population structure, providing context for interpreting cytochrome b variation in evolutionary and ecological studies.

What are the most effective methods for studying molecular adaptation in mitochondrial genes like cytochrome b?

Studying molecular adaptation in mitochondrial genes like cytochrome b requires sophisticated analytical approaches that can detect selection at different temporal and spatial scales. The following integrated methodology represents current best practices:

Sequence-Based Selection Analyses:

  • Codon-Based Methods:

    • Calculate dN/dS ratios (ω) using maximum likelihood approaches

    • Values of ω < 1 indicate purifying selection

    • Values of ω > 1 suggest positive selection

    • Apply tests at different levels:

      • Site-specific: For selection acting consistently on specific amino acids

      • Branch-specific: For lineage-specific selection

      • Branch-site: For episodic selection on specific sites in particular lineages

  • Software Implementation:

    • PAML package (CodeML) for likelihood ratio tests of selection

    • DATAMONKEY web server for complementary approaches

    • HyPhy package for mixed effects model of evolution (MEME)

Structural and Functional Validation:

  • Structure-Function Analysis:

    • Map selected sites onto 3D protein structure

    • Determine proximity to functional domains

    • Assess biochemical properties of amino acid changes

    • Test functional consequences in model systems (e.g., yeast)

  • Comparative Approach:

    • Compare selection patterns across species from different environments

    • Test specific hypotheses about adaptation (e.g., cold adaptation in arctic species)

    • Analyze convergent evolution in independent lineages

Integration with Environmental Data:

  • Ecological Correlation:

    • Test for associations between specific variants and environmental variables

    • Compare species from similar environments (e.g., arctic species like L. arcticus, L. othus, and L. timidus)

    • Examine clinal variation along environmental gradients

  • Historical Context:

    • Incorporate paleoclimatic data

    • Consider demographic history when interpreting selection signals

    • Account for introgression events that may transfer adaptive variants

This integrated approach has revealed evidence of adaptive evolution in mitochondrial genes and demonstrated that variants previously considered neutral may have significant functional effects that could contribute to adaptation to different thermal environments .

How might cytochrome b variation contribute to adaptation to extreme environments in species like Lepus othus?

Cytochrome b variation may play a crucial role in adaptation to extreme environmental conditions, particularly in arctic species like Lepus othus. Current research suggests several mechanisms through which such adaptation might occur:

Thermal Adaptation Mechanisms:

  • Mitochondrial Efficiency Adjustments:

    • Modifications to cytochrome b might alter the efficiency of electron transport

    • Changes in proton pumping efficiency could affect heat generation

    • Altered complex III activity may optimize ATP production at low temperatures

  • Reactive Oxygen Species (ROS) Management:

    • Cytochrome b is a main site of ROS production

    • Variants may modulate ROS generation in response to cold stress

    • This could impact signaling pathways that coordinate nuclear and mitochondrial responses to environmental challenges

  • Protein Stability Adaptations:

    • Amino acid substitutions may enhance protein stability at low temperatures

    • Modifications to transmembrane domains could maintain proper folding in cold conditions

    • Changes in hydrophobicity profiles might optimize function in extreme thermal environments

Evidence from Comparative Studies:

Research on Lepus species provides indirect evidence for adaptive evolution in mitochondrial genes:

  • Arctic species (L. arcticus, L. othus, and L. timidus) share phylogenetic affinities

  • Selection analyses have detected signatures of positive selection in mitochondrial genes

  • Studies suggest that cytochrome b variants previously considered "silent" may have significant functional effects

Research Approaches to Test These Hypotheses:

  • Comprehensive Selection Analysis:

    • Compare cytochrome b sequences across species from different thermal environments

    • Apply branch-site tests focused specifically on lineages adapted to arctic conditions

    • Test for convergent molecular evolution in independent cold-adapted lineages

  • Functional Validation:

    • Express Lepus othus cytochrome b variants in model systems

    • Test biochemical properties at different temperatures

    • Measure effects on complex III activity, ROS production, and thermal stability

  • Integration with Physiological Data:

    • Correlate cytochrome b variants with physiological measurements from arctic species

    • Analyze whole-organism metabolic rates in relation to mitochondrial function

    • Examine tissue-specific expression patterns in thermogenic tissues

This emerging research direction may provide crucial insights into molecular mechanisms of adaptation to climate change and extreme environments.

What are the implications of cytochrome b research for understanding species boundaries in the genus Lepus?

Research on cytochrome b sequences has profound implications for understanding species boundaries in the genus Lepus, challenging traditional taxonomic classifications and revealing complex evolutionary histories:

Phylogenetic Insights:

  • Non-Monophyly of Morphological Species:

    • Cytochrome b data indicate that North American Lepus species do not form a monophyletic group

    • Traditional species designations may not reflect evolutionary relationships

    • Example: L. timidus haplotypes appear throughout the phylogeny, while L. othus forms a well-supported monophyletic clade

  • Cryptic Diversity:

    • Molecular analyses may reveal previously unrecognized diversity

    • Some morphologically defined species may comprise multiple evolutionary lineages

    • Conversely, some distinct morphological species may not be genetically differentiated

Introgression and Hybridization:

  • Mitochondrial Introgression:

    • Evidence of widespread mtDNA introgression between Lepus species

    • Examples include L. timidus mtDNA in L. granatensis, L. corsicanus, and possibly L. townsendii

    • Such patterns complicate species delimitation based solely on mtDNA

  • Historical vs. Contemporary Gene Flow:

    • Some introgression events reflect historical hybridization

    • Analysis of contemporary hybridization requires integration of nuclear markers

    • Microsatellite data can reveal current levels of gene flow between species

Taxonomic Implications:

  • Species Concept Challenges:

    • Biological species concept may be difficult to apply due to hybridization

    • Phylogenetic species concept complicated by mtDNA introgression

    • Integrative approaches combining multiple data types are necessary

  • Taxonomic Reassessments:

    • Cytochrome b data suggest some species' taxonomic status needs reassessment

    • Both splitting and lumping may be warranted in different cases

    • Example: Close relationship between arctic species (L. arcticus, L. othus, L. timidus) may indicate they represent a single widespread species with regional adaptations

Methodological Considerations:

  • Multi-locus Approaches:

    • Complement cytochrome b with nuclear markers

    • Use microsatellites to assess current gene flow

    • Apply genomic approaches for comprehensive species delimitation

  • Integrating Morphological and Ecological Data:

    • Compare molecular patterns with morphological differentiation

    • Consider ecological adaptations when interpreting genetic patterns

    • Apply ecological niche modeling to test for ecological differentiation

This research demonstrates that species boundaries in Lepus are fluid and complex, with important implications for conservation, management, and our understanding of speciation processes in mammals.

What are the key considerations for designing experiments using Recombinant Lepus othus Cytochrome b?

Designing robust experiments with Recombinant Lepus othus Cytochrome b requires careful attention to multiple factors that can influence experimental outcomes and interpretations:

Protein Handling Considerations:

  • Storage and Stability:

    • Maintain at -20°C or -80°C for long-term storage

    • Use working aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

    • Store in Tris-based buffer with 50% glycerol

  • Quality Control:

    • Verify identity through sequence confirmation

    • Assess purity via SDS-PAGE

    • Confirm activity through functional assays

    • Document protein concentration using standardized methods

Experimental Design Factors:

  • Comparative Framework:

    • Include appropriate controls (e.g., wild-type protein, related species)

    • Consider including variants with known functional effects

    • Design experiments to test specific hypotheses about functional domains

  • Methodological Approach:

    • Select appropriate expression systems (bacterial, yeast, mammalian)

    • Consider using yeast models for functional studies

    • Implement biochemical assays measuring complex III activity

    • Develop drug sensitivity assays when relevant

  • Data Analysis Planning:

    • Determine appropriate statistical tests before conducting experiments

    • Calculate required sample sizes for adequate statistical power

    • Plan for multiple replicates (biological and technical)

    • Consider blinding procedures to minimize bias

Interpretation Frameworks:

  • Evolutionary Context:

    • Interpret results in light of the phylogenetic position of Lepus othus

    • Consider adaptive significance in arctic environments

    • Compare with cytochrome b from related species

  • Functional Implications:

    • Relate experimental findings to specific protein domains

    • Consider the broader impact on complex III function

    • Connect results to potential physiological consequences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.