Recombinant Lettuce necrotic yellows virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Overview of Lettuce Necrotic Yellows Virus Glycoprotein G (LNYV G)

Lettuce necrotic yellows virus (LNYV) is a virus species belonging to the Cytorhabdovirus genus . It is endemic to Australia and New Zealand . LNYV has a negative-sense, single-stranded RNA genome that encodes six monocistronic genes . One of these genes encodes Glycoprotein G . Glycoprotein G attaches the virus to the host cell receptor, which induces endocytosis of the virion . Acidic pH in the endosome causes conformational changes in the glycoprotein trimer, triggering fusion between the virus and cell membrane .

Role of Glycoprotein G in Virus-Insect Interactions

Rhabdovirus glycoproteins are important for interactions between the virus and insects . It has been suggested that the glycoprotein is essential for virion attachment and penetration of insect host cells . LNYV is vectored by aphids, including Hyperomyzus lactucae, H. carduellinus, and Nanosovia ribisnigri . When an aphid probes an infected plant, it can acquire virions into its stylet, which then enter the digestive tract, midgut, hemolymph, and salivary gland, replicating in the latter two tissues before being delivered to a new host plant . Glycoprotein G may mediate receptor-mediated endocytosis, helping the virus overcome digestive enzymes and the insect's innate immune response during translocation in the midgut .

Glycoprotein G and LNYV Subgroups

The LNYV population consists of two subgroups, SI and SII . Studies suggest that SII may be outcompeting SI, potentially due to greater vector transmission efficiency or a higher replication rate in its host plant or insect vector . Analysis of LNYV glycoprotein sequences has revealed features and variations that may cause SII to interact with its aphid vector with greater efficiency than SI .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-551
Protein Length
Full Length of Mature Protein
Species
Lettuce necrotic yellows virus (isolate 318) (LNYV)
Target Names
G
Target Protein Sequence
VFNHSVGPLAVCSPDMEDARAYTENCYRRCSRNKEPSTHGYVWLYSDTAPKGGPVVTRCN KVRVKQVFTETWSFSFIKGTPTRMTLDVTEAECVAVMRSQCPTHNCNIKAPSELPEEYHY ASDTEVVQDYLEILSMPSGLDYMEENLRITPSQSKFSFQLTDGKGQEGQYIYFWDTKYDD TKCPFDSFQSHGCDKYDSPLDLINCRESRFVIPSIANSTTLVGACQGLQKSTTGLIYKWD DRPDSIANDSKRIALTKNDQTAGNVATLRVLVADSLNAVDEDLCHTQCEMLDFILRSDRK REVLTRIGGSYLVVSKTSYIRQCRPLVGCRIVKPHYFCGNPNRVAIICHGKVWYWDPLKS YVDEGMNCERRVAGTKLVFAVGNHEYAIDDDMHVELPEHETYGISHDLLASSEDRISKDI VDPTELRNSWQSHIAKEGRMSIEPLSQDKQVSHWDAEFSNPLTWLTSAGGWILDMSHKVT LWATVFLTLGALVAGAKVWEIMRKANRKSQYKRTNTEPHDSQATWI
Uniprot No.

Target Background

Function

This glycoprotein mediates virus attachment to the host cell receptor, triggering virion endocytosis. The ensuing acidic pH within the endosome induces conformational changes in the glycoprotein trimer, initiating fusion between the viral and cellular membranes.

Database Links

KEGG: vg:3844361

Protein Families
Cytorhabdovirus glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is Lettuce necrotic yellows virus (LNYV) and what is its taxonomic classification?

LNYV is a plant virus belonging to the order Mononegavirales, family Rhabdoviridae, and genus Alphacytorhabdovirus (formerly Cytorhabdovirus). It was first identified in Australia in 1963 in Lactuca sativa (lettuce) by Stubbs et al. The virus has a negative-sense, single-stranded RNA genome and is endemic to Australia and New Zealand . The official species name is Alphacytorhabdovirus lactucanecante .

The virus causes severe disease in lettuce characterized by browning of leaf veins, yellowing, stunting, and twisted or lopsided leaves. In advanced stages, outer leaves wilt severely, giving plants a flattened appearance . Unlike nucleorhabdoviruses which replicate in the nucleus, LNYV replicates in the cytoplasm of infected cells, with viral particles budding from the endoplasmic reticulum .

What is the genomic organization of LNYV and where does the glycoprotein G gene reside?

LNYV has a negative-sense, single-stranded RNA genome with six genes flanked by untranslated 3' leader and 5' trailer sequences. The genomic map is 3'-N-4a-4b-M-G-L-5' . These genes encode:

  • N: Nucleoprotein

  • P: Phosphoprotein

  • 4b: Plant-specific movement protein

  • M: Matrix protein

  • G: Glycoprotein

  • L: RNA-dependent RNA polymerase

Intergenic regions contain highly conserved consensus sequences . The G gene, encoding glycoprotein G, is located at the fifth position in the genome between the M and L genes .

What is the biological role of LNYV Glycoprotein G in the virus life cycle?

LNYV Glycoprotein G plays multiple critical roles in the virus life cycle:

  • Host cell attachment and entry: G protein attaches the virus to cellular receptors, inducing endocytosis of the virion. In the endosome, acidic pH induces conformational changes in the G protein trimer, triggering fusion between virus and cell membranes .

  • Vector transmission: The glycoprotein is essential for virion attachment and penetration of insect host cells, mediating the virus-insect vector interactions . This facilitates virus movement through the aphid's digestive tract, midgut, and into the hemolymph and salivary glands .

  • Overcoming host defenses: The glycoprotein helps the virus overcome the insect's innate immune responses through receptor-mediated endocytosis .

  • Determination of vector specificity: Variations in the glycoprotein structure affect virus-vector interactions and transmission efficiency between different viral subgroups .

How does LNYV spread in nature and what vectors are involved in its transmission?

LNYV spread involves specific insect vectors and plant hosts in a complex ecological relationship:

Primary Vectors:

  • Hyperomyzus lactucae (blackcurrant-sowthistle aphid) - main vector

  • H. carduellinus (Asian sowthistle aphid)

  • Nasonovia ribisnigri (blackcurrant lettuce aphid)

Transmission Mechanism:
LNYV is transmitted in a persistent, circulative, and propagative manner . The virus:

  • Is acquired when aphids feed on infected plants

  • Enters the digestive tract and moves to the midgut

  • Passes into the hemolymph where it replicates

  • Infects salivary glands

  • Is transmitted to new host plants during aphid feeding

Natural Reservoir:
The weed Sonchus oleraceus (common sowthistle) serves as the major host of both the virus and the sowthistle aphid . This plant is infected symptomlessly but acts as a crucial virus reservoir .

Transmission Pattern:
Outbreaks typically occur near infected sowthistles. The sowthistle aphid does not breed on lettuce, resulting in limited plant-to-plant spread within lettuce crops .

What structural features of LNYV Glycoprotein G influence vector transmission efficiency?

Research has identified several key structural features of LNYV Glycoprotein G that affect vector transmission efficiency, particularly between subgroups SI and SII:

Key Structural Features:

Experimental Evidence:
3D structure predictions revealed that amino acid changes at positions 244 and 247 alter the predicted structure in ways that potentially enhance vector interaction in SII subgroup viruses .

How can researchers experimentally determine the specific interactions between LNYV Glycoprotein G and aphid receptors?

To determine specific interactions between LNYV Glycoprotein G and aphid receptors, researchers can employ several complementary approaches:

Protein Localization Studies:

  • Express viral proteins fused to fluorescent proteins (GFP/RFP) in leaf epidermal cells

  • Use confocal microscopy to determine subcellular localization

  • Compare localization patterns between different viral glycoproteins, as seen in studies of LNYV, SYNV, and PYDV

Bimolecular Fluorescence Complementation (BiFC):

  • Test protein-protein interactions in planta

  • Can reveal not only if proteins interact but also where in the cell these interactions occur

  • This approach showed that G protein from LNYV is membrane-associated

Receptor Identification in Aphid Vectors:

  • Isolate membrane proteins from Hyperomyzus lactucae midgut and salivary glands

  • Use co-immunoprecipitation with recombinant G protein

  • Employ mass spectrometry to identify interacting proteins

  • Validate interactions using surface plasmon resonance or ELISA

Methodological Table for Aphid Receptor Studies:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentify G protein-interacting aphid proteinsDirect evidence of physical interactionMay not capture weak/transient interactions
Pull-down assays with recombinant G proteinValidate receptor candidatesCan use purified componentsArtificial conditions may affect interactions
RNA interference in aphidsKnock down candidate receptorsTests functional relevanceTechnical challenges in aphid transformation
Yeast two-hybrid screeningScreen aphid cDNA librariesHigh-throughput identificationHigh false positive/negative rates
Cryo-EM of G-receptor complexesStructural analysis of interactionsProvides atomic-level detailRequires stable complex formation

What expression systems are most effective for producing functional recombinant LNYV Glycoprotein G for research purposes?

Different expression systems offer distinct advantages for producing recombinant LNYV Glycoprotein G, each suitable for specific research applications:

coli Cell-Free Expression System:

  • Successfully used to produce recombinant LNYV Glycoprotein G (fragment 26-551 aa) with either His-tag or tag-free versions

  • Advantages: Rapid production, avoids toxicity issues, scalable

  • Applications: Binding assays, functional ELISA, antibody production

  • Limitations: May lack proper post-translational modifications

Insect Cell Expression (Baculovirus):

  • Preferred for structural and functional studies requiring proper folding and post-translational modifications

  • Can produce glycosylated forms of the protein

  • Essential for studies investigating how glycosylation affects vector interactions

  • The structure of C-terminal domains of LNYV phosphoprotein has been solved using proteins expressed in this system, suggesting similar approaches would work for G protein

Plant-Based Expression Systems:

  • Particularly relevant for plant viruses like LNYV

  • Methods include:

    • Transient expression in Nicotiana benthamiana via agroinfiltration

    • Stable transgenic plant expression

  • Advantages: Native-like glycosylation, proper folding environment

  • Can be used to express fluorescently tagged proteins for localization studies

Expression System Comparison Table:

Expression SystemYieldGlycosylationFoldingApplicationsProduction Time
E. coli cell-freeMediumNoneVariableBinding assays, antibody production1-2 days
Baculovirus/insect cellsHighYes (insect-type)GoodStructural studies, functional assays7-10 days
Plant-based transientMediumYes (plant-type)ExcellentIn planta studies, interaction assays5-7 days
Mammalian cellsLow-MediumYes (complex)ExcellentStudies requiring mammalian glycosylation10-14 days
Yeast (P. pastoris)HighYes (high mannose)GoodLarge-scale production7-10 days

What approaches can researchers use to study the structural differences between glycoproteins from different LNYV subgroups?

To investigate structural differences between glycoproteins from different LNYV subgroups (SI and SII), researchers can employ multiple complementary approaches:

Phylogenetic Analysis:

  • Multiple sequence alignments of nucleotide and amino acid sequences using tools like MUSCLE in Geneious

  • Phylogenetic tree construction using Maximum likelihood methods

  • Models such as General Time Reversible with Gamma Distributed pattern for nucleotide analysis and Jones-Taylor-Thornton with Gamma algorithm for amino acid sequence analysis

  • This approach confirmed the existence of two distinct subgroups in New Zealand LNYV isolates

X-ray Crystallography:

  • Express and purify recombinant glycoproteins from both subgroups

  • Crystallize proteins and determine atomic structures

  • Similar approaches were successful in solving the structure of the C-terminal domain of LNYV phosphoprotein

  • Allows atomic-level comparison of structural differences

Disorder Prediction and Domain Analysis:

  • Meta-prediction of disorder (D-score calculation) can identify structured domains

  • This approach successfully identified folded domains in LNYV phosphoprotein

  • Can reveal differences in intrinsically disordered regions between subgroups

Glycosylation Analysis:

  • Mass spectrometry to identify and compare glycosylation patterns

  • Enzymatic deglycosylation assays to assess the role of glycans

  • Site-directed mutagenesis of predicted glycosylation sites

Workflow for Comparative Structural Analysis of LNYV Glycoprotein Subgroups:

  • Isolate virus from field samples and sequence glycoprotein genes

  • Perform phylogenetic analysis to confirm subgroup classification

  • Express recombinant glycoproteins from both subgroups

  • Conduct parallel structural analyses using multiple methods

  • Identify key structural differences that may affect function

  • Validate functional significance through binding and infection assays

What experimental approaches can determine how specific amino acid changes in LNYV Glycoprotein G affect its function?

To determine how specific amino acid changes in LNYV Glycoprotein G affect its function, researchers can implement a systematic experimental workflow combining molecular, structural, and functional approaches:

Site-Directed Mutagenesis:

  • Create single and combined mutations at key positions (particularly 244 and 247) identified in previous research

  • Generate a library of glycoprotein variants using overlap extension PCR or similar techniques

  • Include naturally occurring variations between SI and SII subgroups

Protein Expression and Purification:

  • Express wild-type and mutant glycoproteins in appropriate systems

  • For functional studies, insect or plant expression systems may provide the most relevant post-translational modifications

  • Purify proteins using affinity chromatography (His-tag or other fusion tags)

Structural Analysis of Mutants:

  • Circular dichroism (CD) spectroscopy to assess secondary structure changes

  • Thermal stability assays to determine if mutations affect protein stability

  • X-ray crystallography or cryo-EM for high-resolution structural comparison

  • Mass spectrometry to analyze changes in glycosylation patterns, particularly at N248

Functional Assays:

  • Membrane Fusion Assays: Test the ability of mutant glycoproteins to mediate membrane fusion at different pH values

  • Cell Binding Assays: Quantify binding to insect cell lines derived from aphid vectors

  • Receptor Competition Assays: Determine if mutations alter binding affinity to putative receptors

  • Vector Transmission Studies: Test if specific mutations affect virus acquisition and transmission by aphid vectors

In Planta Protein Localization and Interaction:

  • Express fluorescently tagged mutant glycoproteins in plant cells

  • Use confocal microscopy to assess membrane localization

  • Employ bimolecular fluorescence complementation (BiFC) to evaluate protein-protein interactions

  • Compare with wild-type glycoprotein localization patterns

Experimental Design for Structure-Function Analysis:

PositionMutationRationaleExpected EffectAnalysis Methods
244SI → SIINatural variationAlter Domain III structureStructural analysis, binding assays
247SI → SIINatural variationChange glycosylation at N248Mass spectrometry, fusion assays
N248N → QAbolish glycosylationDetermine glycan importanceVector transmission studies
MultipleSI → SIICombined effectAssess synergistic effectsAll methods
ConservedAlanine scanningIdentify essential residuesFind critical functional sitesAll methods

By systematically applying these approaches, researchers can establish direct connections between specific amino acid changes and functional outcomes, providing insights into the molecular basis of different transmission efficiencies between LNYV subgroups.

How can researchers use recombinant LNYV Glycoprotein G to develop virus-resistant crop varieties?

Developing virus-resistant crop varieties using recombinant LNYV Glycoprotein G involves several strategic approaches that leverage the protein's role in virus-vector interactions:

Competitive Inhibition Strategy:

  • Express recombinant LNYV Glycoprotein G fragments in transgenic lettuce

  • These fragments can:

    • Compete with virus particles for vector receptors

    • Interfere with virus acquisition by aphids

    • Block transmission to new plants

  • Focus on expressing domains involved in receptor binding rather than full-length protein to minimize potential developmental effects

RNA Interference (RNAi) Approach:

  • Design hairpin RNAs targeting conserved regions of the LNYV glycoprotein gene

  • Transform lettuce plants to express these constructs

  • When virus infects, plant-produced siRNAs target viral glycoprotein mRNA for degradation

  • This impairs virus assembly and spread

Receptor Modification Strategy:

  • Identify and characterize plant factors that interact with viral glycoprotein during infection

  • Use CRISPR/Cas9 to modify these host factors without affecting plant fitness

  • Changes that disrupt virus-host interactions while maintaining normal plant function could confer resistance

Decoy Receptor Approach:

  • Create fusion proteins combining:

    • LNYV Glycoprotein G binding domains

    • Plant defense response activators

  • When virus glycoprotein binds to these decoys, they trigger localized defense responses

  • This limits virus spread through hypersensitive response

Subgroup-Specific Protection:

  • Research indicates two LNYV subgroups (SI and SII) with SII outcompeting SI

  • Engineer resistance based on SII glycoprotein to provide broader protection

  • Focus on amino acid positions 244 and 247 that differ between subgroups and affect protein structure and stability

Experimental Design Considerations Table:

ApproachAdvantagesChallengesEvaluation Methods
Competitive inhibitionDirect interference with virus cycleMay affect plant developmentAphid transmission assays
RNAiTargeted silencing, minimal off-targetVirus may evolve resistanceChallenge with different isolates
Receptor modificationDurable resistanceMay affect other pathwaysWhole plant phenotyping
Decoy receptorActivates natural defenseComplex engineering requiredDefense response monitoring
Subgroup targetingAddresses dominant strainsMay not protect against new variantsField trials with natural infection

What methodologies can help researchers understand the evolutionary dynamics of LNYV Glycoprotein G across different isolates?

Understanding the evolutionary dynamics of LNYV Glycoprotein G requires comprehensive methodologies spanning genomics, phylogenetics, and functional analysis:

Molecular Evolution Analysis:

  • Calculate the ratio of nonsynonymous to synonymous nucleotide substitutions (dN/dS)

  • Evidence indicates LNYV genes are under purifying selection

  • Identify specific sites under positive or negative selection using PAML or similar programs

  • Compare selection pressures between different functional domains of the glycoprotein

Phylogeographic Analysis:

  • Collect and sequence LNYV isolates from different geographic regions

  • Construct time-calibrated phylogenetic trees

  • Determine the evolutionary history and dispersal patterns

  • Research has shown LNYV population comprises two subgroups (SI and SII) with different geographic distributions

Functional Divergence Assessment:

  • Express glycoproteins from different evolutionary lineages

  • Compare their:

    • Binding affinity to vector receptors

    • Fusion activity at different pH values

    • Stability under various conditions

    • Glycosylation patterns

  • Correlate functional differences with specific amino acid changes

Host-Vector Co-evolution Studies:

  • Analyze vector populations alongside virus isolates

  • Determine if glycoprotein changes correlate with vector species shifts

  • Investigate potential co-evolutionary relationships between virus, vector, and host

Recombination Analysis:

  • Use algorithms to detect potential recombination events

  • Determine if glycoprotein diversity has been enhanced by recombination

  • Identify potential recombination hotspots within the G gene

Analytical Framework for Evolutionary Studies:

Analysis TypeKey MethodsResearch QuestionsRequired Data
Selection pressurePAML, FEL, MEMEIs glycoprotein under diversifying selection?Multiple sequence alignments from diverse isolates
Population structureSTRUCTURE, BAPSHow many genetic populations exist?Sequence data from multiple locations
Molecular datingBEAST, r8sWhen did subgroups diverge?Time-stamped sequences
Geographic spreadBayesTraits, SPREADHow has LNYV dispersed?Geo-referenced samples
Functional evolutionAncestral reconstructionHow has function changed over time?Experimental validation of reconstructed sequences

Current evidence suggests that SII appears to be outcompeting SI, potentially due to greater vector transmission efficiency or higher replication rates in hosts or vectors . The glycoprotein plays a crucial role in these population dynamics, with specific amino acid changes at positions 244 and 247 affecting structure, glycosylation, and stability .

How can structural information about LNYV Glycoprotein G inform the design of antiviral strategies for crop protection?

Leveraging structural information about LNYV Glycoprotein G enables the design of targeted antiviral strategies for crop protection:

Structure-Based Inhibitor Design:

  • Utilize 3D structural data of LNYV Glycoprotein G to identify potential binding pockets

  • Design small molecule inhibitors that specifically:

    • Block receptor binding sites

    • Interfere with pH-dependent conformational changes required for fusion

    • Disrupt critical glycoprotein-glycoprotein interactions

  • Virtual screening and molecular docking approaches can accelerate candidate discovery

  • Focus on targeting Domain III which is altered between LNYV subgroups SI and SII

Peptide-Based Fusion Inhibitors:

  • Design peptides derived from regions of the glycoprotein involved in conformational changes

  • These can act as dominant-negative inhibitors by:

    • Binding to pre-fusion glycoprotein

    • Preventing fusogenic conformational changes

    • Blocking membrane fusion and virus entry

  • Similar approaches have been successful against other enveloped viruses

Glycosylation-Targeting Approaches:

  • Target the N-linked glycosylation at position N248, which is affected by amino acid changes at positions 244 and 247

  • Design compounds that:

    • Interfere with glycan processing

    • Bind specifically to glycosylated forms of the protein

    • Disrupt glycan-dependent interactions

Neutralizing Antibody Engineering:

  • Use structural information to identify surface-exposed epitopes

  • Generate plant-expressible single-chain antibodies (scFvs) targeting these regions

  • Express these antibodies in transgenic crops to neutralize virus before cell entry

Aptamer Development:

  • Select RNA or DNA aptamers that specifically bind to key structural features of the glycoprotein

  • Express these in transgenic plants to inhibit virus function

  • Design aptamers targeting specific features that differ between subgroups SI and SII for broad protection

Structure-Function Targeting Matrix:

Glycoprotein DomainFunctionStructural FeaturesTargeting StrategyPotential Compounds
Receptor-binding domainHost attachmentSurface loopsCompetitive inhibitorsPeptide mimetics, small molecules
Fusion peptideMembrane fusionHydrophobic regionFusion inhibitorsLipophilic peptides
Domain IIIStructural stabilityAffected by positions 244/247Structure disruptorsConformation-specific binders
N248 glycosylation siteVector interactionN-linked glycanGlycosylation inhibitorsGlycomimetics, lectin-based compounds
Trimer interfaceOligomerizationProtein-protein contactsOligomerization inhibitorsInterface-binding peptides

The effective design of these strategies requires detailed understanding of:

  • The conformational changes the glycoprotein undergoes during the fusion process

  • The specific amino acid differences between subgroups that affect glycoprotein function

  • The glycoprotein's interactions with both plant host factors and aphid vector components

What controls and validation steps are essential when working with recombinant LNYV Glycoprotein G in experimental settings?

When working with recombinant LNYV Glycoprotein G, implementing rigorous controls and validation steps is critical for reliable results:

Protein Expression and Purification Controls:

  • Expression system validation:

    • Express a well-characterized control protein alongside LNYV Glycoprotein G

    • Use Western blot with anti-His tag antibodies for His-tagged constructs

    • Include SDS-PAGE analysis to verify size and purity (>90% purity is recommended)

  • Protein folding verification:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Compare spectra with predictions based on related viral glycoproteins

    • Thermal shift assays to assess protein stability

  • Glycosylation analysis:

    • Use PNGase F treatment to confirm presence of N-linked glycans

    • Mass spectrometry to characterize glycan structures at position N248

    • Compare glycosylation patterns between different expression systems

Functional Assay Controls:

Assay TypePositive ControlNegative ControlValidation Method
Binding assaysKnown ligand (e.g., antibody)Unrelated proteinCompetition assays
ELISAReference glycoprotein preparationBlocking buffer onlyStandard curve
Membrane fusionpH-dependent fusogenic proteinFusion-defective mutantSpectroscopic confirmation
Aphid transmissionWild-type virusUV-inactivated virusqPCR for virus detection
MicroscopyTagged reference proteinUntransfected cellsCo-localization markers

Experimental Design Considerations:

  • Dose-response relationships:

    • Test multiple concentrations of recombinant glycoprotein

    • Determine EC50/IC50 values for accurate comparisons

    • Include appropriate curve-fitting models

  • Biological replicates:

    • Minimum of three independent protein preparations

    • Test across different vector populations when possible

    • Include technical replicates within each biological replicate

  • Cross-validation with different methods:

    • Confirm key findings using complementary techniques

    • For protein localization, combine fluorescent tagging with biochemical fractionation

    • Validate binding interactions with multiple methods (e.g., ELISA, SPR, BiFC )

Specific Recommendations for LNYV Glycoprotein Research:

  • Include both SI and SII variants in comparative studies

  • When testing mutations at positions 244 and 247, include wild-type controls from both subgroups

  • For structural studies, compare with other rhabdovirus glycoproteins like VSV G

  • When studying vector interactions, include multiple aphid species known to transmit LNYV (H. lactucae, H. carduellinus, and N. ribisnigri)

How can researchers troubleshoot common challenges when expressing recombinant LNYV Glycoprotein G in different systems?

Researchers face several challenges when expressing recombinant LNYV Glycoprotein G. Here are systematic troubleshooting approaches for different expression systems:

coli Cell-Free Expression System Challenges:

ChallengePotential CausesTroubleshooting Steps
Low yieldTemplate quality, reaction conditionsOptimize DNA concentration, reaction temperature/time
Protein aggregationImproper folding, hydrophobic regionsAdd detergents/chaperones, express as fragments
Lack of activityMissing post-translational modificationsSwitch to eukaryotic expression systems
Truncated productsCodon bias, premature terminationOptimize codon usage, check mRNA stability

Optimization Strategy: When using E. coli cell-free systems for LNYV Glycoprotein G (as in ), focus on expressing the ectodomain (26-551 aa) rather than the full-length protein to avoid transmembrane region issues.

Insect Cell Expression System Challenges:

ChallengePotential CausesTroubleshooting Steps
Low expressionViral titer, cell healthOptimize MOI, harvest time, cell density
Incorrect glycosylationCell line limitationsTry different insect cell lines (Sf9, High Five)
Secretion issuesSignal sequence problemsOptimize or replace secretion signal
Proteolytic degradationEndogenous proteasesAdd protease inhibitors, reduce temperature

Optimization Strategy: For LNYV Glycoprotein G structural studies, consider approaches similar to those used for the C-terminal domain of LNYV phosphoprotein , adapting expression conditions for membrane proteins.

Plant-Based Expression System Challenges:

ChallengePotential CausesTroubleshooting Steps
Toxicity to plant cellsInterference with host functionsUse inducible promoters, optimize codon usage
Low accumulationProtein instability, silencingCo-express silencing suppressors, target to ER
Inconsistent resultsEnvironmental variablesStandardize growth conditions, use growth chambers
Purification difficultiesPlant compounds interferenceOptimize extraction buffers, use specific tags

Optimization Strategy: When expressing LNYV Glycoprotein G for localization studies in Nicotiana benthamiana, follow protocols established for previous viral protein localization studies , using appropriate subcellular markers.

Universal Troubleshooting Approach:

  • Domain Expression Strategy:

    • Rather than full-length protein, express functional domains separately

    • For LNYV Glycoprotein G, focus on the ectodomain (as in ) or specific domains identified through disorder prediction methods similar to those used for phosphoprotein

  • Fusion Partner Selection:

    • Test multiple fusion tags (His, GST, MBP) to improve solubility and expression

    • Consider removable tags with specific proteases

    • For membrane proteins like G, specialized tags like SUMO may improve folding

  • Expression Optimization Matrix:

    • Systematically test combinations of:

      • Temperature (reduced temperature often helps membrane proteins)

      • Induction time/concentration

      • Media composition

      • Cell density at induction

  • Structural Biology Considerations:

    • For crystallization attempts, remove flexible regions identified through disorder prediction

    • Consider surface entropy reduction mutations

    • Test multiple constructs in parallel with systematic boundary variations

By implementing these systematic troubleshooting approaches, researchers can overcome common challenges in recombinant LNYV Glycoprotein G expression and proceed with functional and structural studies.

How should researchers analyze and interpret contradictory results in LNYV Glycoprotein G studies?

Confronting contradictory results in LNYV Glycoprotein G research requires systematic analysis and resolution strategies:

Methodological Differences Assessment:

Start by examining differences in experimental approaches that may explain contradictory findings:

AspectPotential VariationsResolution Strategy
Protein sourceRecombinant vs. virus-derivedDirect side-by-side comparison using same assays
Expression systemE. coli cell-free vs. insect/plantEvaluate impact of post-translational modifications
Glycoprotein fragmentFull-length vs. ectodomain (26-551 aa) Test multiple constructs with defined boundaries
Viral isolate sourceDifferent geographical regionsSequence analysis to identify variation
Subgroup differencesSI vs. SII variants Include both variants in comparative studies

Statistical Rigor Evaluation:

Assess the statistical validity of conflicting studies:

  • Review sample sizes and power calculations

  • Check for appropriate statistical tests and corrections for multiple comparisons

  • Consider developing a standardized analysis pipeline for LNYV Glycoprotein G studies

  • Implement meta-analysis methods when multiple datasets are available

Biological Variables Resolution Framework:

Variable TypeExamplesInvestigation Approach
Host factorsDifferent plant varietiesTest glycoprotein function in multiple host backgrounds
Vector speciesH. lactucae vs. other aphids Compare transmission by different vector species
Environmental conditionsTemperature, humidityControlled environment studies with multiple parameters
Viral adaptationLaboratory vs. field isolatesCompare recently isolated strains with laboratory strains

Reconciliation Experimental Design:

When facing contradictory results, design specific experiments to address discrepancies:

  • Cross-laboratory validation studies:

    • Exchange materials (plasmids, protein preparations) between labs

    • Implement standardized protocols

    • Conduct parallel experiments with identical materials

  • Combinatorial approach:

    • Test multiple variables simultaneously in factorial design

    • For example, examine both SI and SII glycoproteins across different:

      • pH conditions

      • Temperature ranges

      • Vector species

    • Identify interaction effects that might explain contradictions

  • Sequential hypothesis refinement:

    • Develop a decision tree of experiments

    • Start with experiments that distinguish between major competing hypotheses

    • Progressively narrow down possible explanations

Data Interpretation Framework:

When analyzing contradictory results related to LNYV Glycoprotein G structure-function relationships:

By systematically applying these approaches, researchers can resolve contradictions, refine hypotheses, and advance understanding of LNYV Glycoprotein G biology in a collaborative and rigorous manner.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.