Leuconostoc citreum ATP synthase subunit b (atpF) is a component of the ATP synthase complex in the bacterium Leuconostoc citreum . ATP synthase, also known as F1Fo ATPase, is an enzyme complex present in bacteria, mitochondria, and chloroplasts, responsible for synthesizing adenosine triphosphate (ATP) from adenosine diphosphate (ADP) and inorganic phosphate (Pi) using the energy from a transmembrane electrochemical gradient of protons or sodium ions .
Recombinant Leuconostoc citreum ATP synthase subunit b (atpF) is produced using recombinant DNA technology, where the gene encoding the atpF subunit from Leuconostoc citreum is expressed in a host organism like Escherichia coli . The recombinant protein can then be isolated and purified for research and industrial applications .
ATP synthase is a complex enzyme with two main structural components: F1 and Fo . The F1 component is a peripheral membrane protein complex that contains the catalytic sites for ATP synthesis. The Fo component is an integral membrane protein complex that forms a channel for proton translocation across the membrane. The flow of protons through the Fo channel drives the rotation of a ring of c subunits, which in turn drives the rotation of the γ-stalk in the F1 region . This rotation leads to conformational changes in the α3β3 head, where ADP and inorganic phosphate are converted to ATP .
The atpF subunit, also known as subunit b, is a component of the Fo complex . In E. coli, the atp operon consists of nine genes arranged in the order atpI(i), atpB(a), atpE(c), atpF(b) .
Leuconostoc citreum is a food-grade probiotic bacterium used in food fermentation . It has a role in the production of fermented foods and may contribute to intestinal health as a probiotic . L. citreum can form biofilms, which help the bacteria survive in adverse conditions . The LuxS/AI-2 quorum-sensing system regulates biofilm formation in L. citreum .
Functional Foods: Leuconostoc citreum can be used in the production of functional foods because of its food-grade nature .
Biofilm formation studies: L. citreum is a biofilm-forming strain and can be used to study the genes involved in the LuxS/AI-2 system based on genome sequencing and biofilm formation .
Production of lactic acid: Mutant LMS70, isolated at 70 g/L lactic acid, increased d-lactic acid production up to 76.8 g/L, which was twice that in the wild type (37.8 g/L) .
KEGG: lci:LCK_01631
STRING: 349519.LCK_01631
ATP synthase subunit b (atpF) in Leuconostoc citreum is a critical component of the F0 sector of bacterial ATP synthase enzyme complex. This protein contributes to the peripheral stalk of the ATP synthase, which connects the F1 catalytic domain to the membrane-embedded F0 sector. The atpF subunit plays a crucial role in maintaining the structural integrity of the ATP synthase complex and facilitating energy conversion during ATP synthesis.
In Leuconostoc citreum, the atpF protein consists of 169 amino acids and is encoded by the atpF gene. The protein is also known by several synonyms including "ATP synthase F0 sector subunit b," "ATPase subunit I," "F-type ATPase subunit b," and "F-ATPase subunit b" .
The full amino acid sequence of Leuconostoc citreum ATP synthase subunit b (atpF) consists of 169 amino acids as follows:
MFGLTTLAANKLPLGNMLFIIISFLVLMVILKKVAYGPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELADTRQQATKVVADAKASAQKQSDALVAVAAERANTINQQAQTDAEKLKEDAIANAKNDVAALSVAIASKLMQKELSLNDQQALIDAYISDLETK
This primary structure forms the basis for the protein's functional capacity within the ATP synthase complex. The sequence can be used for designing primers for cloning, creating expression constructs, or planning site-directed mutagenesis experiments.
Bacterial ATP synthases, including that of Leuconostoc citreum, possess a simpler subunit composition compared to their mitochondrial counterparts. The bacterial F1 region consists of subunits α3β3γδε, while the F0 region typically comprises three subunits with the stoichiometry ab2c9-15 .
Some bacteria, such as Paracoccus denitrificans, possess two different but homologous copies of subunit b, named subunits b and b'. This arrangement represents a structural adaptation that may influence the functional properties of these ATP synthases in different cellular environments .
The c-subunit ring in bacterial ATP synthases can vary in size between species, containing anywhere from 9 to 15 c-subunits, which affects the bioenergetic efficiency of the enzyme complex. This variability represents an important area for comparative studies among different bacterial species.
For recombinant production of Leuconostoc citreum ATP synthase subunit b (atpF), Escherichia coli represents the most widely used and effective expression system. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography .
When expressing atpF in E. coli, researchers should consider the following methodological approaches:
Vector selection: pET-series expression vectors under the control of T7 promoter are commonly used
E. coli strain: BL21(DE3) or derivatives are preferred for their reduced protease activity
Induction conditions: IPTG concentration typically 0.5-1.0 mM
Growth temperature: Often reduced to 25-30°C after induction to enhance proper folding
Expression time: 4-6 hours post-induction or overnight at reduced temperatures
The expression in E. coli allows for high-yield production of the recombinant protein while maintaining the structural integrity necessary for downstream applications .
To obtain high-purity recombinant Leuconostoc citreum atpF protein, immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag is the primary purification method. The following purification protocol can be adapted for optimal results:
Cell lysis: Sonication or high-pressure homogenization in appropriate buffer
Clarification: Centrifugation at >20,000g to remove cell debris
IMAC purification: Using Ni-NTA or similar matrices with imidazole gradient elution
Buffer exchange: Removal of imidazole through dialysis or size exclusion chromatography
Quality assessment: SDS-PAGE analysis to confirm >90% purity
For applications requiring exceptionally high purity, secondary purification steps such as ion exchange chromatography or size exclusion chromatography may be employed. The final purified protein should be assessed using SDS-PAGE, with expected purity greater than 90% as reported for commercial preparations .
For long-term stability of recombinant Leuconostoc citreum atpF protein, proper storage conditions are critical. The following recommendations are based on established protocols:
Temperature: Store at -20°C to -80°C for long-term storage
Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles
Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0
Glycerol addition: Add 5-50% glycerol (with 50% being typical) as a cryoprotectant
Working storage: For short-term use (up to one week), store aliquots at 4°C
It is strongly recommended to avoid repeated freeze-thaw cycles as they can lead to protein degradation and loss of structural integrity. When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL before the addition of glycerol for storage .
ATP synthase subunit b (atpF) plays a crucial structural and functional role in the bacterial ATP synthesis mechanism. As part of the peripheral stalk, it helps connect the F1 catalytic domain to the membrane-embedded F0 sector, maintaining proper orientation and distance between these components.
The peripheral stalk, which includes subunit b in bacterial systems, acts as a stator that prevents the α3β3 catalytic complex from rotating with the central stalk during ATP synthesis. This stationary anchor is essential for the rotary catalysis mechanism, allowing the proton gradient-driven rotation of the c-ring to be translated into conformational changes in the F1 catalytic sites .
In bacterial ATP synthases, the F0 region typically contains a stoichiometry of ab2c9-15, with two copies of subunit b forming part of the peripheral stalk. This dimeric arrangement contributes to the structural stability required for efficient energy conversion during ATP synthesis .
Several experimental approaches can be employed to investigate the structure-function relationships of Leuconostoc citreum atpF:
Site-directed mutagenesis:
Target conserved residues identified through sequence alignment
Assess the impact on ATP synthesis activity
Analyze effects on protein-protein interactions within the complex
Cryo-electron microscopy (cryo-EM):
Protein-protein interaction studies:
Cross-linking experiments to identify interaction partners
Co-immunoprecipitation with other ATP synthase subunits
Surface plasmon resonance to quantify binding affinities
Functional reconstitution:
Incorporation of purified recombinant atpF into liposomes
Measurement of ATP synthesis/hydrolysis activities
Assessment of proton translocation efficiency
Recombinant Leuconostoc citreum atpF can serve as a valuable tool in structural biology research through multiple applications:
Crystallography trials:
Either as an individual subunit or part of reconstructed complexes
Can contribute to understanding the peripheral stalk architecture
Cryo-EM studies:
NMR spectroscopy:
Solution structure determination of specific domains
Investigation of dynamic regions and conformational flexibility
Identification of interaction interfaces with other subunits
Molecular dynamics simulations:
Using experimental structures as starting models
Analysis of stability and conformational changes
Investigation of subunit interactions within the complex
For these applications, the availability of highly pure, correctly folded recombinant protein is essential. The His-tagged version allows for affinity purification and potential immobilization for binding studies, while maintaining the structural integrity necessary for meaningful structural analyses .
Structural studies of bacterial ATP synthases, including those from Leuconostoc citreum, face several significant challenges:
Membrane protein complexity:
Difficulty in extracting intact complexes from membranes
Maintaining native lipid environment during purification
Preventing aggregation during concentration
Resolution limitations:
Conformational heterogeneity:
Technical challenges:
Need for specialized approaches like focused refinement for membrane regions
Detergent selection critically impacts structural integrity
Requires sophisticated image processing to achieve high resolution
Recent advances in cryo-EM methodology have helped address some of these challenges, allowing researchers to achieve resolutions between 2.5 and 3.5 Å for the F1 regions, though the F0 regions containing atpF often remain at somewhat lower resolution without specialized processing techniques .
Several promising research directions are emerging in the field of bacterial ATP synthase studies:
Comparative structural biology:
Inhibitor development and mechanisms:
Design of specific inhibitors targeting bacterial ATP synthases
Structure-based drug design exploiting differences between bacterial and human ATP synthases
Understanding resistance mechanisms to ATP synthase inhibitors
Synthetic biology applications:
Engineering ATP synthases with altered substrate specificity
Development of minimal ATP synthase models for biotechnological applications
Creation of hybrid complexes with components from different species
Systems biology integration:
Understanding ATP synthase regulation in the context of bacterial metabolism
Quantitative models of energy conversion efficiency under different conditions
Integration with other bioenergetic systems in bacterial physiology
These research directions represent opportunities to advance our fundamental understanding of bacterial bioenergetics while potentially yielding applications in biotechnology, synthetic biology, and antimicrobial development .
When working with recombinant Leuconostoc citreum atpF, researchers may encounter several common expression issues:
| Problem | Possible Causes | Recommended Solutions |
|---|---|---|
| Low expression yield | Poor codon optimization, toxicity to host | Use codon-optimized sequence, reduce induction temperature to 16-20°C, use C41/C43(DE3) E. coli strains designed for membrane proteins |
| Inclusion body formation | Rapid overexpression, improper folding | Reduce induction temperature, lower IPTG concentration (0.1-0.3 mM), co-express with chaperones |
| Protein degradation | Protease activity, inherent instability | Include protease inhibitors, reduce expression time, use BL21(DE3) pLysS strain |
| Poor solubility | Hydrophobic membrane domains | Add mild detergents (0.1-0.5% DDM) to lysis buffer, evaluate fusion tags that enhance solubility |
| Low purity after IMAC | Non-specific binding to resin | Increase imidazole in wash buffer (20-40 mM), add low concentrations of detergent (0.05% DDM) |
Implementation of these troubleshooting strategies can significantly improve the yield and quality of recombinant atpF protein for downstream applications .
Assessing the proper folding and functionality of recombinant Leuconostoc citreum atpF is critical for ensuring experimental validity:
These complementary approaches provide a comprehensive assessment of whether the recombinant atpF protein has maintained its native fold and functional capabilities, which is essential for meaningful research applications .