Recombinant Leuconostoc citreum ATP synthase subunit b (atpF)

What is ATP synthase subunit b (atpF) in Leuconostoc citreum?

ATP synthase subunit b (atpF) in Leuconostoc citreum is a critical component of the F0 sector of bacterial ATP synthase enzyme complex. This protein contributes to the peripheral stalk of the ATP synthase, which connects the F1 catalytic domain to the membrane-embedded F0 sector. The atpF subunit plays a crucial role in maintaining the structural integrity of the ATP synthase complex and facilitating energy conversion during ATP synthesis.

In Leuconostoc citreum, the atpF protein consists of 169 amino acids and is encoded by the atpF gene. The protein is also known by several synonyms including "ATP synthase F0 sector subunit b," "ATPase subunit I," "F-type ATPase subunit b," and "F-ATPase subunit b" .

What is the complete amino acid sequence of Leuconostoc citreum ATP synthase subunit b?

The full amino acid sequence of Leuconostoc citreum ATP synthase subunit b (atpF) consists of 169 amino acids as follows:

MFGLTTLAANKLPLGNMLFIIISFLVLMVILKKVAYGPLTKVLDERAEKISTDIDGAESARQEAENLAAQRQSELADTRQQATKVVADAKASAQKQSDALVAVAAERANTINQQAQTDAEKLKEDAIANAKNDVAALSVAIASKLMQKELSLNDQQALIDAYISDLETK

This primary structure forms the basis for the protein's functional capacity within the ATP synthase complex. The sequence can be used for designing primers for cloning, creating expression constructs, or planning site-directed mutagenesis experiments.

How does bacterial ATP synthase structure differ from mitochondrial ATP synthases?

Bacterial ATP synthases, including that of Leuconostoc citreum, possess a simpler subunit composition compared to their mitochondrial counterparts. The bacterial F1 region consists of subunits α3β3γδε, while the F0 region typically comprises three subunits with the stoichiometry ab2c9-15 .

Some bacteria, such as Paracoccus denitrificans, possess two different but homologous copies of subunit b, named subunits b and b'. This arrangement represents a structural adaptation that may influence the functional properties of these ATP synthases in different cellular environments .

The c-subunit ring in bacterial ATP synthases can vary in size between species, containing anywhere from 9 to 15 c-subunits, which affects the bioenergetic efficiency of the enzyme complex. This variability represents an important area for comparative studies among different bacterial species.

What expression systems are optimal for recombinant Leuconostoc citreum atpF production?

For recombinant production of Leuconostoc citreum ATP synthase subunit b (atpF), Escherichia coli represents the most widely used and effective expression system. The recombinant protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography .

When expressing atpF in E. coli, researchers should consider the following methodological approaches:

• Vector selection: pET-series expression vectors under the control of T7 promoter are commonly used

• E. coli strain: BL21(DE3) or derivatives are preferred for their reduced protease activity

• Induction conditions: IPTG concentration typically 0.5-1.0 mM

• Growth temperature: Often reduced to 25-30°C after induction to enhance proper folding

• Expression time: 4-6 hours post-induction or overnight at reduced temperatures

The expression in E. coli allows for high-yield production of the recombinant protein while maintaining the structural integrity necessary for downstream applications .

What purification strategies yield highest purity for recombinant atpF?

To obtain high-purity recombinant Leuconostoc citreum atpF protein, immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag is the primary purification method. The following purification protocol can be adapted for optimal results:

• Cell lysis: Sonication or high-pressure homogenization in appropriate buffer

• Clarification: Centrifugation at >20,000g to remove cell debris

• IMAC purification: Using Ni-NTA or similar matrices with imidazole gradient elution

• Buffer exchange: Removal of imidazole through dialysis or size exclusion chromatography

• Quality assessment: SDS-PAGE analysis to confirm >90% purity

For applications requiring exceptionally high purity, secondary purification steps such as ion exchange chromatography or size exclusion chromatography may be employed. The final purified protein should be assessed using SDS-PAGE, with expected purity greater than 90% as reported for commercial preparations .

What are the optimal storage conditions for maintaining stability of recombinant atpF?

For long-term stability of recombinant Leuconostoc citreum atpF protein, proper storage conditions are critical. The following recommendations are based on established protocols:

• Temperature: Store at -20°C to -80°C for long-term storage

• Aliquoting: Divide into single-use aliquots to avoid repeated freeze-thaw cycles

• Buffer composition: Tris/PBS-based buffer with 6% trehalose at pH 8.0

• Glycerol addition: Add 5-50% glycerol (with 50% being typical) as a cryoprotectant

• Working storage: For short-term use (up to one week), store aliquots at 4°C

It is strongly recommended to avoid repeated freeze-thaw cycles as they can lead to protein degradation and loss of structural integrity. When reconstituting lyophilized protein, it should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL before the addition of glycerol for storage .

How does bacterial ATP synthase subunit b contribute to ATP synthesis mechanism?

ATP synthase subunit b (atpF) plays a crucial structural and functional role in the bacterial ATP synthesis mechanism. As part of the peripheral stalk, it helps connect the F1 catalytic domain to the membrane-embedded F0 sector, maintaining proper orientation and distance between these components.

The peripheral stalk, which includes subunit b in bacterial systems, acts as a stator that prevents the α3β3 catalytic complex from rotating with the central stalk during ATP synthesis. This stationary anchor is essential for the rotary catalysis mechanism, allowing the proton gradient-driven rotation of the c-ring to be translated into conformational changes in the F1 catalytic sites .

In bacterial ATP synthases, the F0 region typically contains a stoichiometry of ab2c9-15, with two copies of subunit b forming part of the peripheral stalk. This dimeric arrangement contributes to the structural stability required for efficient energy conversion during ATP synthesis .

What experimental approaches can be used to study atpF structure-function relationships?

Several experimental approaches can be employed to investigate the structure-function relationships of Leuconostoc citreum atpF:

• Site-directed mutagenesis:

  • Target conserved residues identified through sequence alignment

  • Assess the impact on ATP synthesis activity

  • Analyze effects on protein-protein interactions within the complex

• Cryo-electron microscopy (cryo-EM):

  • High-resolution structural determination (3.0-3.2 Å resolution achievable)

  • Visualization of different rotational states

  • Focused refinement of the F0 region containing atpF

• Protein-protein interaction studies:

  • Cross-linking experiments to identify interaction partners

  • Co-immunoprecipitation with other ATP synthase subunits

  • Surface plasmon resonance to quantify binding affinities

• Functional reconstitution:

  • Incorporation of purified recombinant atpF into liposomes

  • Measurement of ATP synthesis/hydrolysis activities

  • Assessment of proton translocation efficiency

How can recombinant atpF be used in structural biology research?

Recombinant Leuconostoc citreum atpF can serve as a valuable tool in structural biology research through multiple applications:

• Crystallography trials:

  • Either as an individual subunit or part of reconstructed complexes

  • Can contribute to understanding the peripheral stalk architecture

• Cryo-EM studies:

  • Component for in vitro reconstitution of ATP synthase complexes

  • Structural comparison between bacterial species

  • Analysis of conformational states during catalytic cycle

• NMR spectroscopy:

  • Solution structure determination of specific domains

  • Investigation of dynamic regions and conformational flexibility

  • Identification of interaction interfaces with other subunits

• Molecular dynamics simulations:

  • Using experimental structures as starting models

  • Analysis of stability and conformational changes

  • Investigation of subunit interactions within the complex

For these applications, the availability of highly pure, correctly folded recombinant protein is essential. The His-tagged version allows for affinity purification and potential immobilization for binding studies, while maintaining the structural integrity necessary for meaningful structural analyses .

What are the key challenges in structural studies of bacterial ATP synthases?

Structural studies of bacterial ATP synthases, including those from Leuconostoc citreum, face several significant challenges:

• Membrane protein complexity:

  • Difficulty in extracting intact complexes from membranes

  • Maintaining native lipid environment during purification

  • Preventing aggregation during concentration

• Resolution limitations:

  • F0 regions typically resolve at lower resolution than F1 regions in cryo-EM

  • Local resolution varies across different parts of the complex

  • Peripheral stalk components like atpF can be particularly challenging to resolve at high resolution

• Conformational heterogeneity:

  • Multiple rotational states present in any preparation

  • Requires classification of particle images into distinct conformational classes

  • Different proportions of states (e.g., 45%, 35%, and 20% distribution observed in some studies)

• Technical challenges:

  • Need for specialized approaches like focused refinement for membrane regions

  • Detergent selection critically impacts structural integrity

  • Requires sophisticated image processing to achieve high resolution

Recent advances in cryo-EM methodology have helped address some of these challenges, allowing researchers to achieve resolutions between 2.5 and 3.5 Å for the F1 regions, though the F0 regions containing atpF often remain at somewhat lower resolution without specialized processing techniques .

What are emerging research directions for bacterial ATP synthase studies?

Several promising research directions are emerging in the field of bacterial ATP synthase studies:

• Comparative structural biology:

  • High-resolution structures of ATP synthases from diverse bacterial species

  • Identification of species-specific adaptations in peripheral stalk architecture

  • Understanding how variations in c-ring stoichiometry affect bioenergetic efficiency

• Inhibitor development and mechanisms:

  • Design of specific inhibitors targeting bacterial ATP synthases

  • Structure-based drug design exploiting differences between bacterial and human ATP synthases

  • Understanding resistance mechanisms to ATP synthase inhibitors

• Synthetic biology applications:

  • Engineering ATP synthases with altered substrate specificity

  • Development of minimal ATP synthase models for biotechnological applications

  • Creation of hybrid complexes with components from different species

• Systems biology integration:

  • Understanding ATP synthase regulation in the context of bacterial metabolism

  • Quantitative models of energy conversion efficiency under different conditions

  • Integration with other bioenergetic systems in bacterial physiology

These research directions represent opportunities to advance our fundamental understanding of bacterial bioenergetics while potentially yielding applications in biotechnology, synthetic biology, and antimicrobial development .

What are common issues in recombinant atpF expression and how can they be resolved?

When working with recombinant Leuconostoc citreum atpF, researchers may encounter several common expression issues:

Implementation of these troubleshooting strategies can significantly improve the yield and quality of recombinant atpF protein for downstream applications .

How can the proper folding and function of recombinant atpF be assessed?

Assessing the proper folding and functionality of recombinant Leuconostoc citreum atpF is critical for ensuring experimental validity:

These complementary approaches provide a comprehensive assessment of whether the recombinant atpF protein has maintained its native fold and functional capabilities, which is essential for meaningful research applications .