Recombinant Leuconostoc citreum Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

MscL: General Characteristics and Function

MscL is a pentameric ion channel that responds to membrane tension, acting as an "emergency release valve" in bacteria . Key features include:

PropertyDescriptionSource
StructurePentameric assembly with two transmembrane helices (TM1 and TM2) per subunit
ConductanceLarge (~3 nS in lipid bilayers)
Pressure SensitivityActivated at ~10–12 mN/m membrane tension
InhibitionBlocked by gadolinium ions

Note: Data derived from E. coli MscL studies due to lack of direct L. citreum mscL research.

Genetic Engineering in L. citreum

ToolDescriptionApplicationSource
High-Copy PlasmidspCB4270 plasmid (~70 copies/cell) with FACS-optimized replication originOverexpression of recombinant proteins
Bicistronic DesignLeader peptide + target gene under single promoter for enhanced expressionCo-expression of multiple proteins

These systems could theoretically be adapted for MscL expression.

Hypothetical Recombinant L. citreum MscL: Challenges and Opportunities

If engineered, recombinant MscL in L. citreum would face:

Potential Challenges

  • Membrane Compatibility: MscL’s activity depends on lipid bilayer composition. L. citreum’s membrane may differ from E. coli’s, affecting channel gating .

  • pH Sensitivity: L. citreum thrives in acidic environments (pH 4.0–6.3) , which may conflict with MscL’s optimal functionality (neutral pH) .

Potential Applications

  • Biotechnological Stress Sensors: MscL could monitor osmotic pressure during fermentation, aiding process optimization.

  • Protein Engineering: Leveraging L. citreum’s metabolic pathways (e.g., mannitol synthesis) for novel MscL variants.

Research Gaps and Future Directions

  • Structural Studies: No crystal structures of L. citreum MscL homologues exist. Comparative modeling with E. coli MscL (PDB: 2OAR) could guide engineering .

  • Functional Validation: Patch-clamp electrophysiology or liposome reconstitution assays would confirm MscL activity in L. citreum .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your preparation.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; LCK_01226; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Leuconostoc citreum (strain KM20)
Target Names
mscL
Target Protein Sequence
MLSEFKTFIMRGNVLDLAVGVIIGGAFTGIVKSLTNNLISPIITFFTGGTSDLQNLKLVV TKELTFKYGAFLNDVINFLITAFVVFLLVKFVNRILRTNKKEEVKANPELEVLAEIRDLL EAQKKA
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological function of MscL in Leuconostoc citreum?

MscL primarily functions as a pressure-relief valve that protects bacterial cells from lysis during acute osmotic downshock . When L. citreum cells experience hypoosmotic conditions, water rapidly enters the cell, increasing turgor pressure. This creates tension in the cell membrane, which activates MscL channels. When activated, MscL opens a large nonselective pore (approximately 30 Å wide) with a conductance of ~3 nS, allowing the rapid efflux of cytoplasmic solutes and preventing cell rupture . During stationary phase and osmotic shock conditions, MscL expression is upregulated to enhance this protective mechanism .

How is the structure of MscL related to its function?

The MscL channel consists of five identical subunits, each containing two transmembrane helices (TM1 and TM2) . This structural arrangement is critical for its mechanosensing capabilities:

  • The transmembrane domains are arranged in a tight conformation in the closed state, creating a hydrophobic gate that prevents ion passage

  • Upon membrane tension, the transmembrane helices undergo significant tilt angle changes in a helix-pivoting motion

  • The periplasmic loop region transforms from a folded structure during channel opening

  • The channel forms a funnel-shaped pore, with the wider opening facing the periplasmic side and the narrowest constriction near the cytoplasm

This structural design allows the channel to directly couple membrane tension to conformational changes, creating a sensitive mechanical force transducer that responds precisely to osmotic challenges .

How does the L. citreum MscL respond to mechanical stress?

The MscL response to mechanical stress involves several biophysical steps:

  • Membrane tension creates hydrophobic mismatch between the protein and lipid bilayer

  • This mismatch applies forces to the transmembrane domains of MscL

  • The channel gates via changes in membrane curvature and transbilayer pressure profile

  • The response follows a predictable relationship described by the Laplace-Young equation: σ = 2rΔP, where σ is membrane tension, r is patch curvature, and ΔP is applied negative pressure

  • Activation occurs at a membrane tension threshold of approximately 11.8 mN/m²

  • The channel undergoes a conformational change with ΔA (change in membrane area) of about 6.5 nm²

  • The free energy difference between closed and open states (ΔG°) is approximately 46 kJ/mol

This mechanism allows precise sensing of membrane tension and appropriate channel responses to protect cell integrity.

What expression systems are effective for recombinant production of L. citreum MscL?

For recombinant expression of L. citreum proteins, including MscL, a bicistronic design (BCD) expression system has been developed with excellent results . This system offers several advantages:

  • The BCD includes a short leader peptide (1st cistron) followed by the target gene (2nd cistron) under control of a single promoter

  • An engineered Shine-Dalgarno sequence (eSD2) for the 2nd cistron significantly enhances expression

  • The optimized promoter (P710V4) isolated through FACS screening provides strong transcriptional activity

  • This system demonstrated substantially higher protein production compared to both the original BCD and monocistronic design (MCD) systems

For heterologous expression in mammalian systems, successful expression of bacterial MscL has been achieved in neuronal cells, suggesting that with appropriate vector design and codon optimization, L. citreum MscL could be expressed in diverse host systems .

What methods are used to assess MscL function in experimental settings?

Functional assessment of MscL channels utilizes several complementary techniques:

Electrophysiological methods:

  • Patch-clamp recordings with calibrated suction pressures offer direct measurement of channel activity

  • Measurement of conductance (G) using the relationship I = G × V (current = conductance × voltage)

  • Assessment of tension-dependent response to determine activation thresholds

Structural analysis methods:

  • Comparative analysis of structures in different states (closed, intermediate, open) using X-ray crystallography or cryo-EM

  • Analysis of conformational changes in transmembrane helices tilt angles and periplasmic loop regions

Cell-based assays:

  • Cell survival assays during osmotic downshock with and without functional MscL

  • Measurement of solute efflux rates upon osmotic challenge

For neuronal applications, additional assessment techniques include:

  • Evaluation of neuronal network development (synaptic puncta counts)

  • Monitoring of spontaneous network activity

  • Cell survival assessment in mechano-sensitized neurons

How can genetic diversity analysis inform MscL research with L. citreum?

Multilocus sequence typing (MLST) studies on L. citreum strains reveal considerable genetic diversity that could impact MscL research . Key considerations include:

  • Analysis of 13 L. citreum strains from South Korean foods identified 51 polymorphic sites and 13 distinct sequence types

  • Housekeeping genes used for typing (atpA, dnaA, dnaK, gyrB, pheS, pyrG, and rpoA) showed varying degrees of polymorphism, with allele numbers ranging from 2 (gyrB) to 10 (dnaK)

  • Intragenic recombination has been detected through combined splits tree analysis

  • No clear relationship between isolation sources and strain clustering was observed

This genetic diversity suggests potential functional variations in the MscL protein across different L. citreum strains. Researchers should consider strain-specific differences when selecting L. citreum sources for MscL studies or applications.

What are the key differences between MscL and other mechanosensitive channels?

MscL displays several distinguishing characteristics compared to other mechanosensitive channels:

FeatureMscL (Large Conductance)MscS (Small Conductance)Eukaryotic MS Channels
Conductance~3 nS (very large) Lower than MscLTypically much lower
Pore diameter~30 Å when open Smaller than MscLGenerally smaller
StructureHomopentamer HomoheptamerVarious (often tetrameric)
Gating tension~11.8 mN/m² Lower than MscLVariable, often lower
SelectivityNon-selectiveSlight anion preferenceOften highly selective
Expression regulationUpregulated during osmotic shock Different regulation patternComplex tissue-specific regulation
Transmembrane regionsTwo per subunit Three per subunitVariable

These differences reflect the specialized roles of different mechanosensitive channels in various cellular contexts and organisms.

What are the molecular mechanisms of MscL gating at the atomic level?

Structural studies comparing different conformational states of MscL reveal a sophisticated molecular mechanism for mechanotransduction :

  • Transmembrane helix rearrangements:

    • TM1 and TM2 undergo significant changes in tilt angles consistent with the helix-pivoting model

    • These movements expand the central pore from a tightly closed hydrophobic gate to an open conduction pathway

  • Periplasmic domain transitions:

    • The periplasmic loop transforms from a folded structure in the closed state

    • This transformation contributes to the coordinated movement that allows channel opening

  • Force transmission pathway:

    • Mechanical force from the lipid bilayer is transmitted to the transmembrane helices

    • The resulting conformational changes propagate through the protein structure

    • This creates a coordinated movement of multiple structural elements

  • Energetics of gating:

    • Channel opening involves overcoming an energy barrier of approximately 46 kJ/mol

    • The process is associated with an increase in protein cross-sectional area of about 6.5 nm²

    • The energetic cost reflects the extensive conformational rearrangements needed for channel opening

These atomic-level details reveal MscL as a highly sophisticated nanoscale valve with precisely coordinated movements that translate membrane tension into channel gating.

How can engineered L. citreum MscL be applied in neuroscience research?

Recombinant MscL offers unique opportunities for neuroscience applications through mechano-sensitization of neuronal networks :

  • Remote neuronal stimulation:

    • Heterologous expression of engineered MscL in neurons creates mechano-sensitized neural circuits

    • This enables non-invasive mechanical stimulation of specific neuronal populations

    • The approach could provide an alternative to current electrical, chemical, or optical stimulation methods

  • Experimental validation:

    • Functional expression has been confirmed through patch-clamp recordings with calibrated suction pressures

    • MscL-expressing neuronal networks show normal development regarding:

      • Cell survival rates

      • Formation of synaptic connections (puncta)

      • Spontaneous network activity patterns

  • Advantages over other approaches:

    • Pure mechanosensitivity without requiring cofactors or specialized equipment

    • Cell-type-specific expression can be achieved through appropriate promoters

    • Wide genetic modification library allows customization of channel properties

    • Potential for developing new mechano-genetic approaches for neuroscience and neurology

  • Potential therapeutic applications:

    • May enable novel approaches for treating neurological disorders

    • Could provide alternatives to current neuromodulation techniques

    • Offers possibilities for targeted, non-invasive intervention in neural circuits

What strategies can optimize heterologous expression of functional L. citreum MscL?

Optimizing heterologous expression of functional L. citreum MscL requires addressing several challenges specific to membrane proteins:

  • Expression system selection:

    • The bicistronic design (BCD) system with engineered Shine-Dalgarno sequence (eSD2) and promoter (P710V4) has proven highly effective for L. citreum proteins

    • For mammalian expression, neuronal-specific promoters and appropriate vector systems have demonstrated success with bacterial MscL

  • Codon optimization:

    • Adapt the L. citreum mscL gene sequence to the codon usage bias of the host organism

    • Remove rare codons that might cause translational pausing or premature termination

  • Membrane integration strategies:

    • Include appropriate signal sequences to direct the protein to the cell membrane

    • Consider fusion tags that facilitate membrane insertion while maintaining channel function

    • Optimize the expression temperature to balance protein production with proper folding

  • Functional validation approaches:

    • Implement patch-clamp protocols to verify mechanosensitivity

    • Use fluorescent tagging to confirm membrane localization

    • Employ osmotic challenge assays to assess channel functionality

  • Protein stabilization methods:

    • Identify and modify residues that might cause instability in heterologous systems

    • Consider co-expression with chaperones to aid proper folding

    • Optimize culture conditions (temperature, induction timing, media composition) to enhance functional expression

These strategies can be combined and fine-tuned based on the specific host system and research objectives.

How can structural information about MscL inform the development of novel antimicrobial approaches?

The structural and functional details of MscL present opportunities for novel antimicrobial strategies :

  • MscL as an antimicrobial target:

    • The channel's essential role in osmoregulation makes it a potential target for new antibiotics

    • Compounds that inappropriately activate MscL could disrupt bacterial osmoregulation

    • Structural data on the closed and intermediate states provides templates for rational drug design

  • Potential approaches:

    • Development of compounds that lock MscL in an open state, causing cellular content leakage

    • Design of molecules that alter MscL gating tension thresholds, making bacteria vulnerable to normal osmotic fluctuations

    • Creation of antimicrobial peptides that specifically interact with MscL's transmembrane domains

  • Advantages against antimicrobial resistance:

    • Novel target different from conventional antibiotics

    • Mechanical rather than biochemical mechanism of action

    • Potential activity against multiple drug-resistant bacterial strains

    • Difficulty for bacteria to develop resistance to compounds affecting mechanical properties

  • Challenges and considerations:

    • Need for specificity to target bacterial MscL without affecting host mechanosensitive channels

    • Delivery of compounds to the bacterial membrane in effective concentrations

    • Potential variability in MscL structure and function across bacterial species

The detailed structural understanding of MscL gating mechanics provides a foundation for developing these innovative antimicrobial approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.