Recombinant Leuconostoc citreum UPF0397 protein LCK_00164 (LCK_00164)

Shipped with Ice Packs
In Stock

Description

Production Methodology

For research applications, the recombinant protein is produced using Escherichia coli as an expression system. The full-length protein is fused with an N-terminal histidine tag to facilitate purification through affinity chromatography. This expression system provides significant yields while maintaining the protein's structural integrity . The purification process typically results in a product with greater than 90% purity as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) .

Physical Properties

The recombinant LCK_00164 protein is typically supplied in lyophilized powder form, which enhances stability during storage and transportation. After production, the protein undergoes extensive quality control to ensure consistency and reliability for downstream applications . When properly reconstituted, the protein maintains its structural integrity and functional properties.

Reconstitution Protocol

Proper reconstitution is critical for maintaining the protein's activity. The recommended protocol involves:

  1. Brief centrifugation of the vial before opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of glycerol (5-50% final concentration) for long-term storage

  4. Aliquoting for storage at -20°C to -80°C

This careful reconstitution process ensures that the protein maintains its structural integrity and biological activity for subsequent experimental applications.

Potential Therapeutic Applications

The observed effects of Leuconostoc citreum on adipogenesis and lipid metabolism suggest potential applications in treating obesity and associated metabolic disorders. The bacteria's ability to increase lipolysis by activating AMPK-α while suppressing lipogenic enzymes indicates a possible mechanism for reducing fat accumulation . Furthermore, the elevation of adiponectin levels in treated adipocytes suggests improvements in insulin sensitivity, which could be beneficial for managing type 2 diabetes and metabolic syndrome .

Relation to Other Leuconostoc citreum Proteins

While investigating LCK_00164, it's worth noting that Leuconostoc citreum produces other well-characterized proteins with established functions. For instance, the Mur protein, an atypical peptidoglycan hydrolase, has been identified and characterized from Leuconostoc citreum . Unlike LCK_00164, the Mur protein has well-established enzymatic activity in peptidoglycan hydrolysis, highlighting the diverse protein repertoire of this bacterial species .

This comparison provides context for understanding the potential functional significance of LCK_00164 within the broader proteome of Leuconostoc citreum and related bacteria.

Current Research Applications

The recombinant LCK_00164 protein has applications primarily in basic research, including:

  1. Structure-function studies of membrane proteins

  2. Comparative analyses of bacterial membrane proteins

  3. Investigation of protein-protein interactions within bacterial membranes

  4. Exploration of bacterial adaptation mechanisms

These applications leverage the protein's carefully controlled production and high purity to provide reliable experimental results .

Potential Biotechnological Applications

Based on studies of Leuconostoc citreum metabolites, proteins from this organism may have applications in:

  1. Development of probiotic formulations targeting metabolic disorders

  2. Creation of novel anti-obesity agents

  3. Design of functional foods with metabolic benefits

  4. Production of diagnostic tools for metabolic research

The anti-adipogenic and lipolysis-promoting effects demonstrated by Leuconostoc citreum extracts suggest that specific proteins, potentially including LCK_00164, might contribute to these beneficial effects and could be developed into therapeutic applications .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
LCK_00164; UPF0397 protein LCK_00164
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Leuconostoc citreum (strain KM20)
Target Names
LCK_00164
Target Protein Sequence
MHNQKKNQGFSVKSVVATGIGAAVFFVLMKFIAIPTGVPNTTINVAEGWLALIAGLFGPV VGLLVGLIGHTLNDAVTYGAPWWSWVIADGVFGLLLGFGKKYLALEYGELTTKKLVQFNV WQAVSNVLVWVIIAPLGDIIIYKEAAQKVFLQGAVTTVVNTISVAIIGSLLLVAYVKSRP KKSSLRSE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the recombinant LCK_00164 protein typically expressed and what expression systems are most effective?

The recombinant LCK_00164 protein is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The full-length protein (1-188 amino acids) is expressed using standard bacterial expression vectors under the control of inducible promoters .

For optimal expression, researchers should consider the following methodology:

  • Transform expression vectors into competent E. coli strains optimized for recombinant protein expression (BL21(DE3) or similar)

  • Culture in LB or TB media supplemented with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8

  • Induce expression with IPTG (typically 0.1-1 mM) and reduce temperature to 18-25°C for 16-20 hours

  • Harvest cells by centrifugation and proceed with purification

Alternative expression systems have been less extensively studied, though lactic acid bacterial hosts might provide advantages for functional studies of this protein, particularly when investigating membrane integration properties .

What are the optimal storage conditions for maintaining protein stability and activity?

The lyophilized recombinant LCK_00164 protein requires specific storage conditions to maintain stability. The following research-validated protocols are recommended:

  • Upon receipt, store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot to minimize freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • For long-term storage, keep at -20°C/-80°C in Tris/PBS-based buffer with 6% trehalose, pH 8.0

Repeated freeze-thaw cycles significantly impact protein stability and should be strictly avoided. Research indicates that aliquoting is essential for maintaining consistent experimental results across extended research timelines .

What are the primary research applications for recombinant LCK_00164 protein?

While specific research applications for LCK_00164 protein are still emerging, functional genomics studies of Leuconostoc species suggest several key areas where this protein may be investigated:

  • Membrane biology studies: As a putative membrane protein, LCK_00164 can be utilized in research examining bacterial membrane structure and function

  • Comparative genomics: The protein serves as a model for studying conserved hypothetical proteins within lactic acid bacteria

  • Metabolic pathway analysis: Recent comparative genomic studies of Leuconostoc species have highlighted the importance of membrane proteins in sugar transport and metabolism

  • Structural biology: Crystallization and structural determination studies to elucidate the function of UPF0397 family proteins

Research by comparative genomics approaches has positioned Leuconostoc proteins, including LCK_00164, as important components in understanding bacterial adaptation to different ecological niches and substrates, particularly in food fermentation environments .

How can recombinant LCK_00164 protein be effectively incorporated into protein-protein interaction studies?

For investigating protein-protein interactions involving LCK_00164, researchers should consider these methodological approaches:

  • Pull-down assays: Utilize the His-tag for immobilization on Ni-NTA or similar matrices to identify binding partners from cellular lysates

  • Cross-linking experiments: Chemical cross-linking followed by mass spectrometry to identify proximal proteins in native environment

  • Yeast two-hybrid screening: Modified membrane-based Y2H systems may be suitable for this membrane protein

  • Bacterial two-hybrid systems: More appropriate for membrane proteins than conventional Y2H

  • Co-immunoprecipitation: Using anti-His antibodies or protein-specific antibodies if available

When designing these experiments, researchers should consider the membrane localization of the protein. Detergent solubilization protocols must be carefully optimized to maintain native protein conformation while allowing effective solubilization. Typical starting detergents include mild non-ionic options such as DDM (n-Dodecyl-β-D-maltoside) or CHAPS at concentrations just above their critical micelle concentration .

What purification strategies yield the highest purity and recovery for LCK_00164 protein?

The following purification protocol is recommended based on published research involving similar membrane proteins from lactic acid bacteria:

StepMethodBuffer CompositionNotes
1Cell Lysis50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, protease inhibitorsSonication or high-pressure homogenization
2Membrane ExtractionAddition of 1% DDM or similar detergentGentle stirring for 1-2 hours at 4°C
3IMACSame buffer + 0.05% detergentElution with 250-300 mM imidazole gradient
4Size Exclusion20 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.03% DDMRemoves aggregates and improves purity
5ConcentrationSame as SEC bufferUsing 10 kDa MWCO concentrators

When purifying membrane proteins like LCK_00164, maintaining detergent concentration above critical micelle concentration throughout all steps is crucial for preventing aggregation. Additionally, for functional studies, reconstitution into lipid nanodiscs or liposomes may be necessary to study the protein in a membrane-like environment .

What analytical methods are most suitable for characterizing the structural integrity of purified LCK_00164?

For comprehensive structural characterization of purified LCK_00164 protein, researchers should employ multiple complementary techniques:

  • Circular Dichroism (CD) Spectroscopy: Provides information on secondary structure elements and can monitor thermal stability

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines oligomeric state and homogeneity in solution

  • Differential Scanning Fluorimetry (DSF): Assesses thermal stability under various buffer conditions

  • Limited Proteolysis: Identifies stable domains and flexible regions

  • Mass Spectrometry: Confirms protein identity, post-translational modifications, and sequence integrity

For membrane proteins like LCK_00164, specialized techniques such as detergent screening arrays can help identify optimal solubilization conditions that maintain native structure. Assessment of protein stability in different detergents is particularly important before proceeding to functional characterization studies .

How can CRISPR/Cas9 genetic engineering be applied to study LCK_00164 in its native Leuconostoc citreum context?

Recent advances in Leuconostoc citreum genetic engineering using CRISPR/Cas9 systems can be applied to study LCK_00164 function in its native context. The following methodology has been validated for genetic manipulation of L. citreum:

  • Construct design: Design a CRISPR/Cas9 system targeting the LCK_00164 gene, including:

    • Cas9 expression cassette

    • Guide RNA targeting specific sequences within LCK_00164

    • Homology-directed repair template for gene deletion or modification

  • Transformation: Transform the "killer" plasmid expressing Cas9 and guide RNA into L. citreum using electroporation protocols optimized for this bacterium

  • Selection and verification: Select transformants and verify gene modifications using PCR and sequencing

  • Plasmid curing: Remove the CRISPR plasmid through serial subculture without antibiotics

  • Phenotypic analysis: Compare wild-type and mutant strains to determine functional effects

This approach has been successfully applied to eliminate cryptic plasmids in L. citreum and can be adapted for genomic modifications. When designing guide RNAs for LCK_00164, researchers should ensure specificity and efficiency by selecting target sequences with minimal off-target effects .

What metabolic pathways in Leuconostoc citreum might involve LCK_00164 based on comparative genomic analyses?

Comparative genomic analyses of Leuconostoc species provide insights into potential metabolic roles of LCK_00164. While specific functional characterization is limited, membrane proteins in Leuconostoc are often involved in the following metabolic pathways:

  • Carbohydrate transport: As a membrane protein, LCK_00164 may participate in sugar uptake systems, particularly given the importance of PTS and ABC transporters in Leuconostoc metabolism

  • Phosphoketolase pathway: Central to Leuconostoc metabolism, membrane proteins often interface with this pathway by facilitating substrate transport

  • Flavor compound production: Membrane proteins in Leuconostoc species frequently contribute to the production of diacetyl, acetoin, and 2,3-butanediol through regulation of precursor transport

The metabolic reconstruction of Leuconostoc species has revealed distinctive adaptations to different ecological niches, with membrane proteins playing crucial roles in these adaptations. When studying LCK_00164, researchers should consider both central metabolism and species-specific pathways that might involve this protein .

What biosafety considerations apply to research with recombinant LCK_00164 protein?

Research involving recombinant LCK_00164 protein falls under the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules. Key regulatory considerations include:

  • Institutional Biosafety Committee (IBC) approval: Required for experiments involving recombinant DNA at institutions receiving NIH funding

  • Biosafety level: Work with non-pathogenic Leuconostoc citreum derivatives typically requires BSL-1 containment practices

  • Documentation requirements: Maintain records of:

    • Risk assessment

    • Experimental protocols

    • Laboratory practices

    • Personnel training

  • International compliance: For international collaborations, both NIH guidelines and host country regulations must be followed

Researchers should note that while L. citreum is generally recognized as safe, recombinant proteins may require additional risk assessment based on their potential biological activities. The expression of membrane proteins should be evaluated for possible effects on cell membrane integrity or metabolic functions that might alter risk profiles .

How should researchers address reproducibility challenges when working with membrane proteins like LCK_00164?

Ensuring reproducibility when working with membrane proteins presents unique challenges. Researchers should implement the following best practices:

  • Detailed methods reporting: Document complete protocols including:

    • Expression conditions (temperature, induction time, media composition)

    • Precise detergent types and concentrations

    • Buffer compositions at each purification stage

    • Storage conditions and stability data

  • Quality control metrics: Establish and report criteria for:

    • Purity assessment (SDS-PAGE, Western blot)

    • Functional assays (if developed)

    • Structural integrity checks (CD spectroscopy, thermal stability)

  • Batch validation: Compare protein batches using consistent analytical methods and establish acceptance criteria

  • Data sharing: Deposit complete protocols in repositories like Protocols.io and raw data in appropriate databases

For membrane proteins like LCK_00164, detergent selection and concentration are critical variables affecting experimental outcomes. Researchers should systematically evaluate multiple detergents and document their effects on protein stability and activity to enable robust cross-laboratory reproducibility .

What are the key future research directions for understanding LCK_00164 function?

Based on current knowledge, several promising research directions emerge for elucidating the function of LCK_00164:

  • Structure determination: X-ray crystallography or cryo-EM studies to resolve the three-dimensional structure, potentially revealing functional motifs not apparent from sequence analysis alone

  • Interactome mapping: Comprehensive protein-protein interaction studies to identify binding partners and place LCK_00164 in its functional context

  • Comparative functional genomics: Systematic comparison with homologous proteins in other lactic acid bacteria to identify conserved functions

  • Metabolic profiling: Metabolomic analysis of wildtype versus knockout strains to identify affected metabolic pathways

  • Heterologous expression systems: Development of specialized expression systems in different host organisms to facilitate functional studies

The growing database of Leuconostoc genomes provides rich comparative material for placing LCK_00164 in evolutionary context. Integration of structural biology, genetics, and systems biology approaches presents the most promising path toward comprehensive functional characterization of this protein and the broader UPF0397 family .

How does LCK_00164 compare to similar proteins in other Leuconostoc species?

Comparative analysis across Leuconostoc species reveals insights about the conservation and potential specialization of LCK_00164:

SpeciesProtein HomologSequence IdentityNotable Differences
L. citreumLCK_00164100% (reference)-
L. mesenteroidesSimilar UPF0397 family protein~80-85% (estimated)Variations in transmembrane domains
L. carnosumSimilar UPF0397 family protein~75-80% (estimated)N-terminal region differences
L. gelidumSimilar UPF0397 family protein~70-75% (estimated)Higher variability in cytoplasmic loops

Phylogenomic analysis of Leuconostoc species has revealed that metabolic potential, including membrane protein functions, often clusters according to ecological niches and adaptation. The conservation pattern of LCK_00164 across species suggests it plays a role in core cellular functions, though species-specific variations may reflect adaptations to different environmental conditions or metabolic specializations .

The combination of comparative sequence analysis with functional genomics approaches offers a powerful strategy for uncovering the biological role of this conserved but poorly characterized protein family in lactic acid bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.