Recombinant Leuconostoc gasicomitatum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ecfT; LEGAS_1699; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Leuconostoc gelidum subsp. gasicomitatum (strain DSM 15947 / CECT 5767 / JCM 12535 / LMG 18811 / TB1-10)
Target Names
ecfT
Target Protein Sequence
MNNIMIGRFVPGNSWIHRLDPRTKMIVTFVYIIVMLWASNWQTYAWTAAFVVAMVKLTDQ PFKLYWDGLKPIFWLILFTVILQLLFTPGTPILFSVGPFQVTVPGILNAIYVMVRFVLII LMSTILTLTTPPTSIANALESLLSPLKKIGVPVAELALMLAIALRFVPLLMDEMQKIMNA QKSRGMSFSTGGPIKRAKAIIPLLIPLFIGALQRALDLANAMEVRGFKDAVQRTKYRILS YQKIDKVAFAALIGFVIIFFVIKTWLHG
Uniprot No.

Target Background

Function
EcfT is the transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters, this ECF transporter provides the energy necessary for the transport of a diverse range of substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Energy-coupling factor transporter transmembrane protein EcfT?

Energy-coupling factor transporter transmembrane protein EcfT (also known as ECF transporter T component EcfT) is a crucial membrane protein component of the Energy-coupling factor (ECF) transport system in Leuconostoc gelidum subsp. gasicomitatum. This protein consists of 268 amino acids and functions as part of a transporter complex involved in the uptake of various micronutrients, particularly vitamins and trace metals, across the bacterial cell membrane. The protein contains multiple transmembrane domains that anchor the ECF complex in the membrane, facilitating the energy-dependent transport process .

What is the taxonomic classification of Leuconostoc gasicomitatum?

Leuconostoc gasicomitatum has undergone taxonomic reclassification based on phylogenomic analyses. Current classification places it as a subspecies of Leuconostoc gelidum, designated as Leuconostoc gelidum subsp. gasicomitatum. This reclassification was established through DNA-DNA relatedness studies showing more than 70% similarity between L. gelidum and L. gasicomitatum strains. The type strain for this subspecies is LMG 18811T (equivalent to DSM 15947T) . Phylogenomic analysis places L. gelidum and L. gasicomitatum in closely related but distinct clades, with L. gasicomitatum forming group G7 alongside L. inhae strains, which show ANI values greater than 98% with L. gasicomitatum strains .

What are the optimal storage conditions for recombinant EcfT protein?

For optimal preservation of recombinant EcfT protein functionality, the following storage conditions are recommended:

Storage PurposeTemperatureFormulationDuration
Long-term storage-20°C to -80°CIn Tris/PBS-based buffer with 50% glycerol, pH 8.0Months to years
Working aliquots4°CIn Tris/PBS-based bufferUp to one week
Lyophilized form-20°CLyophilized powderExtended periods

It is crucial to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity and activity. For this reason, preparing multiple small-volume aliquots before freezing is highly recommended. When using frozen samples, allow them to thaw completely at 4°C rather than at room temperature to minimize protein degradation .

How should recombinant EcfT protein be reconstituted for experimental use?

For proper reconstitution of lyophilized recombinant EcfT protein:

  • Briefly centrifuge the vial containing lyophilized protein prior to opening to ensure all material is at the bottom of the tube.

  • Reconstitute in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL.

  • For storage stability, add glycerol to a final concentration of 5-50% (with 50% being optimal for most applications).

  • Gently mix by inversion rather than vortexing to avoid protein denaturation.

  • Allow the protein to sit at 4°C for 30 minutes after reconstitution for complete solubilization.

  • Aliquot into multiple small volumes to avoid repeated freeze-thaw cycles.

This methodological approach ensures maximum retention of protein structure and function for subsequent experimental applications .

What expression systems are most effective for producing recombinant EcfT?

Based on the available data, Escherichia coli expression systems have been successfully employed for the production of recombinant Leuconostoc gasicomitatum EcfT protein. The recombinant protein is typically expressed with an N-terminal histidine tag to facilitate purification using affinity chromatography.

For optimal expression:

  • Select an appropriate E. coli strain (BL21(DE3) or derivatives) that minimizes protein degradation.

  • Use a vector system with an inducible promoter (such as T7) to control expression timing.

  • Optimize induction conditions (inducer concentration, temperature, duration) to maximize soluble protein yield.

  • Consider using specialized strains for membrane proteins that may help with proper folding and insertion.

  • Implement a purification strategy that maintains the native conformation of the transmembrane regions, possibly including detergents or lipid environments.

This methodological approach addresses the particular challenges associated with expressing integral membrane proteins like EcfT .

How can researchers study the structural dynamics of EcfT protein?

To investigate the structural dynamics of the EcfT protein, researchers can employ a multifaceted approach combining:

  • Cryo-electron microscopy (Cryo-EM): This technique can reveal the three-dimensional structure of the EcfT protein, particularly in complex with other ECF transporter components, providing insights into functional conformations.

  • Molecular dynamics simulations: Using the amino acid sequence and predicted transmembrane topology, researchers can simulate the behavior of EcfT within a lipid bilayer environment under different conditions.

  • Site-directed mutagenesis: Strategic mutation of key residues within the transmembrane domains can help identify regions critical for proper folding, membrane insertion, and function.

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can identify proximities between different regions of the protein and interaction partners.

  • Fluorescence resonance energy transfer (FRET): By labeling specific domains of the protein, researchers can monitor conformational changes during transport cycles.

These methodological approaches, when used in combination, can provide comprehensive insights into how the structure of EcfT relates to its function in energy-coupled transport mechanisms .

What experimental approaches can be used to study EcfT's transmembrane transport activities?

To investigate the transmembrane transport activities of EcfT, researchers should consider implementing these experimental approaches:

  • Reconstitution in liposomes: Purified EcfT, along with other ECF complex components, can be reconstituted into liposomes to create a controlled environment for transport assays.

  • Electrophysiological measurements: Using techniques such as patch-clamp or planar lipid bilayer recordings to detect ion movements associated with transport activity.

  • Fluorescent substrate analogs: Developing fluorescent analogs of natural substrates can allow real-time monitoring of transport kinetics.

  • Isotope flux assays: Using radiolabeled substrates to quantitatively measure transport rates and substrate specificity.

  • In vivo transport assays: Creating knockout and complementation strains in Leuconostoc or heterologous hosts to assess transport function in cellular contexts.

  • Membrane potential monitoring: Using voltage-sensitive dyes to determine how EcfT function affects or is affected by membrane potential.

This methodological toolkit allows researchers to characterize the transport properties, substrate specificity, energetics, and regulation of the EcfT-containing ECF transporter complex .

How does the EcfT protein from L. gasicomitatum compare with homologs in related species?

A comprehensive comparative analysis of EcfT proteins across Leuconostoc species reveals significant evolutionary and functional insights:

SpeciesSequence Identity (%)Structural SimilaritiesFunctional Differences
L. gelidum subsp. gelidum>90%Conserved transmembrane domainsPotentially different substrate specificity
L. inhae>85%Similar topologyMay have adapted to different microenvironments
Other Leuconostoc spp.70-85%Core ECF structures preservedVaried substrate ranges reflecting ecological niches

Phylogenetic analysis indicates that EcfT proteins cluster according to the evolutionary relationships established for Leuconostoc species. The close relationship between L. gasicomitatum and L. inhae (with ANI values >98%) suggests their EcfT proteins may have very similar functions, while more distant relatives in the G2-G5 clades likely show more divergent functional characteristics .

To investigate these relationships methodologically, researchers should:

  • Perform multiple sequence alignments to identify conserved and variable regions

  • Use homology modeling to predict structural differences

  • Conduct heterologous expression studies to compare functional parameters

  • Analyze gene neighborhood conservation to understand operon structure variation

This approach provides valuable insights into the evolution of transport mechanisms across the Leuconostoc genus .

What are the challenges in purifying and maintaining functional EcfT protein?

Purifying and maintaining functional EcfT protein presents several challenges that researchers must address:

  • Membrane protein solubilization: As an integral membrane protein, EcfT requires careful selection of detergents for extraction from membranes without denaturing its structure. Researchers should test a panel of detergents (such as DDM, LDAO, or CHAPS) at various concentrations to optimize solubilization.

  • Maintaining native conformation: The transmembrane domains of EcfT are critical for function but prone to misfolding when removed from the lipid bilayer environment. Consider using lipid nanodiscs, amphipols, or reconstitution into liposomes to maintain native structure.

  • Protein aggregation: EcfT may aggregate during concentration steps. This can be mitigated by:

    • Adding glycerol (5-10%) to purification buffers

    • Maintaining low protein concentrations (<1 mg/mL)

    • Including stabilizing agents such as specific lipids

  • Complex formation requirements: EcfT functions as part of a multi-component ECF transporter complex. For functional studies, co-expression or reconstitution with partner proteins may be necessary.

  • Validation of functional integrity: After purification, assessing whether the protein remains functional requires specialized assays, such as substrate binding or transport reconstitution studies.

These methodological challenges require careful optimization at each step of the purification process to obtain functionally relevant results .

How can researchers validate the structural integrity of recombinant EcfT?

To validate the structural integrity of purified recombinant EcfT protein, researchers should implement a multifaceted approach:

  • SDS-PAGE analysis: Confirm protein purity and expected molecular weight (approximately 30-32 kDa for the 268 amino acid EcfT protein plus any tags).

  • Circular dichroism (CD) spectroscopy: Assess secondary structure content to verify the expected high alpha-helical content typical of transmembrane proteins.

  • Tryptophan fluorescence spectroscopy: Monitor the local environment of tryptophan residues, which can indicate whether the protein is properly folded.

  • Size-exclusion chromatography: Confirm monodispersity and appropriate oligomeric state, helping to detect potential aggregation.

  • Thermal stability assays: Techniques like differential scanning fluorimetry (DSF) can assess protein stability and the effects of different buffer conditions.

  • Limited proteolysis: Properly folded proteins often show characteristic resistance patterns to proteolytic digestion compared to misfolded variants.

  • Binding assays with known interaction partners: Verify functionality through interaction studies with other ECF transporter components or substrate binding.

This comprehensive validation approach ensures that the recombinant EcfT protein maintains its native structure, which is essential for meaningful functional studies .

What bioinformatic approaches are useful for analyzing EcfT sequence and function?

Bioinformatic analysis of EcfT can provide valuable insights into its structure, function, and evolution using these methodological approaches:

  • Transmembrane topology prediction: Tools such as TMHMM, Phobius, or TOPCONS can predict the membrane-spanning regions of EcfT, essential for understanding its structural organization.

  • Homology modeling: Using structures of related ECF transporters as templates, researchers can generate three-dimensional models of EcfT to predict functional domains and interaction interfaces.

  • Phylogenetic analysis: Constructing phylogenetic trees of EcfT sequences across bacterial species helps trace evolutionary relationships and potential functional divergence.

  • Conserved domain analysis: Tools like InterPro or PFAM can identify functional domains within EcfT and their conservation across homologs.

  • Protein-protein interaction prediction: Computational methods can identify potential interaction surfaces between EcfT and other components of the ECF transporter complex.

  • Coevolution analysis: Methods such as direct coupling analysis (DCA) can identify co-evolving residues that may be functionally linked.

  • Gene neighborhood analysis: Examining the genomic context of ecfT can provide insights into its functional associations and potential operon structures.

These computational approaches complement experimental studies by generating testable hypotheses about structural features, functional mechanisms, and evolutionary relationships of EcfT .

What is the evolutionary significance of EcfT in Leuconostoc species?

The evolutionary significance of EcfT in Leuconostoc species must be understood within the broader context of bacterial adaptation and speciation:

EcfT proteins represent a conserved component of nutrient acquisition systems that has likely played a key role in the adaptation of Leuconostoc species to diverse ecological niches. Phylogenomic analysis indicates that Leuconostoc species have diverged into distinct clades (labeled G1-G18), with L. gasicomitatum forming group G7 alongside L. inhae. This clustering pattern suggests that EcfT evolution has followed species diversification .

Comparative genomic analyses suggest that EcfT has evolved to support the specific nutritional requirements of Leuconostoc species in their respective environments. The conservation of EcfT across the genus underscores its essential role in bacterial physiology, while sequence variations may reflect adaptations to different micronutrient availability in various ecological niches .

How does understanding EcfT contribute to broader knowledge of bacterial transport systems?

Understanding the structure and function of EcfT from L. gasicomitatum provides significant insights into the broader field of bacterial transport mechanisms:

  • Diversification of transport mechanisms: EcfT represents an energy-coupling module in the ECF class of transporters, which differs structurally and mechanistically from other transport systems like ABC transporters. Studying EcfT helps elucidate how bacteria have evolved diverse strategies for nutrient acquisition.

  • Energy coupling in membrane transport: Research on EcfT contributes to our understanding of how energy (ATP hydrolysis) is coupled to substrate translocation across membranes, a fundamental aspect of cellular bioenergetics.

  • Modular architecture of transporters: The ECF transporters, including EcfT, demonstrate how bacteria use modular protein components to create versatile transport systems capable of handling diverse substrates with shared energetic components.

  • Adaptation to nutrient limitation: EcfT-containing transporters typically handle vitamins and trace nutrients, providing insights into bacterial strategies for survival in nutrient-limited environments.

  • Evolutionary conservation and divergence: Comparative analysis of EcfT across bacterial species reveals patterns of conservation in energy-coupling mechanisms while showing divergence in substrate specificity, illustrating evolutionary principles in protein function.

This research contributes to the fundamental understanding of membrane biology and bacterial physiology, with potential applications in synthetic biology, antimicrobial development, and biotechnology .

What research gaps exist in our understanding of EcfT's role in Leuconostoc physiology?

Despite current knowledge about EcfT in Leuconostoc gasicomitatum, several significant research gaps remain:

  • Substrate specificity determination: The precise range of substrates transported by the EcfT-containing complex in L. gasicomitatum remains uncharacterized. Systematic transport assays with various vitamins and micronutrients would provide valuable insights into its physiological role.

  • Regulatory mechanisms: How the expression and activity of EcfT are regulated in response to environmental conditions, substrate availability, or growth phase is poorly understood.

  • Interaction network: The complete set of protein-protein interactions involving EcfT, including potential interactions beyond the core ECF complex, requires further investigation using techniques such as protein cross-linking and co-immunoprecipitation coupled with mass spectrometry.

  • Structural dynamics during transport: The conformational changes that EcfT undergoes during the transport cycle remain largely uncharacterized. High-resolution structural studies in different states of the transport cycle would provide mechanistic insights.

  • Role in bacterial adaptation: How variations in EcfT contribute to the ability of different Leuconostoc species to adapt to specific ecological niches is an important area for exploration.

  • Comparative physiology: Systematic comparison of EcfT function across the newly defined Leuconostoc species groups (G1-G18) would provide insights into how transporter evolution relates to species diversification.

Addressing these research gaps would significantly advance our understanding of bacterial transport mechanisms and the specific physiological adaptations of Leuconostoc species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.