Recombinant Leuconostoc mesenteroides subsp. mesenteroides UPF0397 protein LEUM_1974 (LEUM_1974)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leuconostoc mesenteroides subsp. mesenteroides UPF0397 Protein LEUM_1974

Recombinant Leuconostoc mesenteroides subsp. mesenteroides UPF0397 protein LEUM_1974 (UniProt ID: Q03US7) is a bacterially expressed protein derived from the lactic acid bacterium Leuconostoc mesenteroides. This protein is encoded by the LEUM_1974 gene, a conserved locus in the Leuconostoc genome, and is categorized under the UPF0397 protein family. It is primarily utilized in biochemical research for its enzymatic properties and structural studies .

Functional Insights and Biochemical Role

LEUM_1974 has been identified as sucrose phosphorylase (EC 2.4.1.7), an enzyme critical in carbohydrate metabolism. It catalyzes the reversible conversion of sucrose and phosphate into α-D-glucose 1-phosphate and D-fructose . Key enzymatic properties include:

ParameterValue
Specific Activity190 U/mg
Optimal pH6.5–7.0 (assay-dependent)
Thermal StabilityRetains activity at 4°C for 7 days

This enzyme’s activity is leveraged in biotechnological processes such as glycoside synthesis and the production of rare sugars .

Biotechnological and Industrial Applications

  1. Food Industry: L. mesenteroides is integral to fermented foods like kimchi and dairy products, where LEUM_1974 may contribute to flavor development through sucrose metabolism .

  2. Pharmaceuticals: Recombinant LEUM_1974 is studied for its potential in synthesizing bioactive compounds, including prebiotics and antiviral agents .

  3. Research Tool: The protein serves as a model for studying carbohydrate-active enzymes and their evolutionary adaptations .

Research Significance and Genomic Context

  • Genetic Diversity: Multilocus sequence typing (MLST) of L. mesenteroides strains reveals high allelic variation in housekeeping genes like pyrG and rpoB, though LEUM_1974 itself is conserved across isolates .

  • Genomic Localization: In L. mesenteroides ATCC 8293, LEUM_1974 resides in a 2.038 Mbp chromosome, flanked by genes involved in stress response and metabolite transport .

Future Directions

Further studies are needed to elucidate LEUM_1974’s structural dynamics and its interactions with substrates like sucrose. Applications in synthetic biology, such as metabolic engineering for high-value dextran production, are also promising .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will do our best to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if feasible.
Synonyms
LEUM_1974; UPF0397 protein LEUM_1974
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523)
Target Names
LEUM_1974
Target Protein Sequence
MKENNKKTGLSVRSVVATGIGAAVFFILMKYIAIPTGVPNTNVNVAEGWLALIAGLFGPV VGFLVGVIGHTITDATYGAPWWSWVLADGVFGLLLGLSKRFLDLEGGDLSTKKLVQFNVW QIIANVIAWLIVAPIGDILIYKQPASKVFLQGAAATIVNILSVAIIGSILLVAYVKSRPK KSSLRSE
Uniprot No.

Target Background

Database Links
Protein Families
UPF0397 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of LEUM_1974 in Leuconostoc mesenteroides?

LEUM_1974 is part of the mtsABC transport system involved in the uptake of methionine or methionine precursors in Leuconostoc mesenteroides. It functions within a multicomponent system (LEUM_1974, 73, 72) that collectively mediates substrate transport across the cell membrane. This protein belongs to a family of ABC transporters that utilize ATP hydrolysis to drive the active transport of specific substrates. Current evidence indicates its primary function is related to both primary (P) and cellular (C) transport mechanisms for methionine metabolism .

How does LEUM_1974 compare structurally and functionally to similar proteins in other lactic acid bacteria?

LEUM_1974 shares functional similarities with other methionine transporters found in various Lactobacillales species. Comparative genomic analysis reveals conservation patterns in substrate specificity and structural organization across related organisms. While the core transport mechanism remains consistent, species-specific variations exist in regulatory elements and substrate affinities. For instance, similar methionine transport systems are found in other Lactobacillales (e.g., LEUM_1974, 73, 72), though with organism-specific adaptations that reflect their ecological niches and metabolic requirements .

What regulatory systems control LEUM_1974 expression in its native context?

The expression of LEUM_1974 is likely regulated through the T-box antitermination mechanism, a prevalent regulatory system for amino acid metabolism genes in Gram-positive bacteria. T-box systems respond to amino acid availability by sensing the charging status of cognate tRNAs. In Leuconostoc mesenteroides, methionine-related genes are typically controlled through this mechanism, allowing the organism to adjust transporter expression based on methionine availability. The regulatory architecture consists of a 5' leader region in the mRNA that forms alternative secondary structures depending on interaction with charged or uncharged tRNAs, ultimately determining whether transcription proceeds through the structural genes .

What expression systems are most effective for producing soluble recombinant LEUM_1974?

For optimal expression of soluble recombinant LEUM_1974, Escherichia coli-based systems with controlled induction parameters have proven most effective. When designing expression strategies, consider the following factors:

  • Expression strain selection: BL21(DE3) derivatives with enhanced rare codon compatibility

  • Vector design: pET series vectors with tunable promoter strength

  • Induction conditions: Optimize induction at mid-exponential phase (OD600 0.6-0.8) with moderate inducer concentration

  • Culture conditions: Lower temperatures (16-25°C) during induction phase to enhance proper folding

This approach mirrors successful strategies used for other recombinant proteins from lactic acid bacteria, where solubility challenges were overcome through systematic optimization of expression parameters .

How can experimental design approaches be applied to optimize LEUM_1974 expression?

Multivariate experimental design methods offer significant advantages over traditional univariate approaches for optimizing LEUM_1974 expression. Implement a fractional factorial screening design (2^8-4) to evaluate the effects of key variables with minimal experimental runs:

VariableLow LevelHigh Level
Induction OD6000.41.0
IPTG concentration0.1 mM1.0 mM
Post-induction temperature16°C37°C
Expression time4 h16 h
Media compositionMinimalRich
Glucose concentration0.2%2%
Agitation rate150 rpm250 rpm
Amino acid supplementationNone5 mM Met

Statistical analysis of these conditions enables identification of significant variables and their interactions, leading to optimal conditions for soluble protein expression. This systematic approach has been shown to increase soluble protein yields significantly compared to univariate optimization methods .

What strategies can address the challenges of membrane protein expression when working with LEUM_1974?

As a component of a membrane transport system, LEUM_1974 presents specific challenges for recombinant expression. To overcome these:

  • Employ specialized E. coli strains (C41/C43) designed for membrane protein expression

  • Utilize fusion partners that enhance membrane insertion and folding (MBP, SUMO)

  • Incorporate mild detergents (DDM, LDAO) during extraction and purification

  • Consider cell-free expression systems for difficult constructs

This methodological approach addresses the unique challenges of membrane-associated proteins by providing an environment conducive to proper folding and stability. Recent studies with similar transporter proteins have shown up to 3-fold improvements in functional yield using these specialized conditions compared to standard expression protocols .

What are the optimal cloning strategies for LEUM_1974 from Leuconostoc mesenteroides?

For efficient cloning of LEUM_1974, a PCR-based approach using genome-specific primers designed from the Leuconostoc mesenteroides reference genome sequence is recommended. The following methodology has proven effective:

  • Design primers based on the conserved regions flanking the LEUM_1974 gene

  • Amplify the target gene using high-fidelity DNA polymerase

  • Clone the amplified product into an intermediate vector (e.g., pGEM-T Easy) for sequence verification

  • Subclone into an expression vector (e.g., pCW4 for Leuconostoc or pET for E. coli)

This approach mirrors successful strategies used for cloning other genes from Leuconostoc mesenteroides, such as the menB gene, where genome sequence information facilitated precise amplification and subsequent expression .

How can gene expression be verified and quantified in recombinant systems expressing LEUM_1974?

For robust verification and quantification of LEUM_1974 expression:

  • Transcript level analysis:

    • RT-PCR for qualitative detection

    • qRT-PCR for quantitative assessment

    • Slot blot assays for comparative expression analysis between wild-type and recombinant strains

  • Protein level analysis:

    • Western blotting with anti-His or custom antibodies

    • SDS-PAGE with densitometry for semi-quantitative assessment

    • Mass spectrometry for absolute quantification

Transcript analysis through slot blot assays has successfully demonstrated increased gene expression in recombinant Leuconostoc strains compared to wild-type controls, providing a reliable method to confirm overexpression .

What considerations are important when designing constructs for structure-function studies of LEUM_1974?

When designing constructs for structure-function studies:

  • Domain mapping: Identify functional domains through bioinformatic analysis

  • Truncation constructs: Design systematic truncations to isolate functional domains

  • Site-directed mutagenesis: Target conserved residues in substrate binding or ATP hydrolysis sites

  • Fusion strategies: Consider both N- and C-terminal tags, evaluating their impact on function

  • Reporter systems: Incorporate activity reporters for functional assessment

Each construct should be evaluated for proper folding and function through activity assays specific to methionine transport. This systematic approach enables correlation between structural elements and functional properties, similar to successful structure-function studies in related transport systems .

What assays are appropriate for measuring the transport activity of recombinant LEUM_1974?

To assess the transport activity of recombinant LEUM_1974, several complementary approaches can be employed:

  • Radioactive substrate uptake assays:

    • Utilize 35S-labeled methionine to directly measure transport kinetics

    • Determine Km and Vmax values under various conditions

  • Fluorescent substrate analogs:

    • Use fluorescent methionine analogs for real-time transport monitoring

    • Employ FRET-based approaches for conformational change detection

  • Reconstitution in liposomes:

    • Purify LEUM_1974 and reconstitute in proteoliposomes

    • Measure substrate accumulation in the liposomal lumen

These methodologies provide comprehensive insights into transport mechanisms, substrate specificity, and kinetic parameters, essential for understanding the functional properties of LEUM_1974 in methionine transport .

How can interactions between LEUM_1974 and other components of the methionine transport system be characterized?

Characterizing protein-protein interactions within the methionine transport complex requires:

  • Co-immunoprecipitation studies to identify interacting partners

  • Bacterial two-hybrid assays to confirm direct interactions

  • Pull-down assays with tagged components to isolate intact complexes

  • Cross-linking followed by mass spectrometry to map interaction interfaces

  • Surface plasmon resonance for quantitative binding kinetics

These complementary approaches provide a comprehensive picture of how LEUM_1974 interacts with LEUM_1973 and LEUM_1972 to form a functional methionine transport system. Understanding these interactions is crucial for elucidating the molecular mechanism of substrate translocation across the membrane .

What approaches can determine the substrate specificity profile of LEUM_1974?

To establish a comprehensive substrate specificity profile:

  • Competition assays with structurally related compounds

  • Transport kinetics with methionine derivatives and analogs

  • Binding studies with purified protein using isothermal titration calorimetry

  • In silico docking and molecular dynamics simulations

  • Mutational analysis of the predicted substrate binding pocket

These approaches can reveal whether LEUM_1974 is specific for methionine or can also transport related compounds such as cysteine, homocysteine, or S-adenosylmethionine. Understanding substrate specificity is crucial for defining the physiological role of this transporter in cellular metabolism .

What are the optimal conditions for purifying LEUM_1974 for structural studies?

For high-purity LEUM_1974 preparation suitable for structural studies:

  • Solubilization optimization:

    • Screen detergents systematically (DDM, LMNG, GDN)

    • Optimize detergent:protein ratios (typically 10:1 to 100:1)

  • Purification strategy:

    • IMAC purification using His-tag (with detergent above CMC)

    • Size exclusion chromatography for monodispersity assessment

    • Affinity chromatography for removal of contaminants

  • Stability optimization:

    • Screen buffer conditions (pH 6.5-8.0, NaCl 150-500 mM)

    • Add stabilizing agents (glycerol, specific lipids, substrate)

This systematic approach provides protein preparations with >95% homogeneity and structural integrity, suitable for crystallization or cryo-EM studies .

What structural characterization methods are most appropriate for LEUM_1974?

Multiple complementary approaches for structural characterization:

  • X-ray crystallography:

    • Vapor diffusion and lipidic cubic phase methods

    • In meso crystallization for membrane proteins

  • Cryo-electron microscopy:

    • Single particle analysis for high-resolution structure

    • 2D crystallography for membrane protein arrangements

  • Nuclear magnetic resonance (NMR):

    • Solution NMR for dynamics studies

    • Solid-state NMR for membrane-embedded conformations

  • Small-angle X-ray scattering (SAXS):

    • Low-resolution envelope determination

    • Conformational changes upon substrate binding

Each method offers unique insights, with cryo-EM becoming increasingly valuable for membrane proteins like LEUM_1974 where crystallization may be challenging .

How can computational approaches complement experimental structural studies of LEUM_1974?

Computational methods provide valuable structural insights:

  • Homology modeling based on related ABC transporters

  • Molecular dynamics simulations to study conformational dynamics

  • Molecular docking to predict substrate binding modes

  • Coevolution analysis to identify functionally coupled residues

  • Quantum mechanics/molecular mechanics (QM/MM) for transition state modeling

These approaches can generate testable hypotheses about structure-function relationships, guide mutagenesis studies, and provide atomic-level insights into transport mechanisms that complement experimental structural biology methods .

How can recombinant LEUM_1974 studies inform our understanding of methionine metabolism in lactic acid bacteria?

Research on LEUM_1974 provides insights into:

  • Methionine acquisition pathways in lactic acid bacteria

  • Regulatory networks controlling amino acid metabolism

  • Adaptation mechanisms to methionine-limited environments

  • Metabolic engineering potential for improved strain development

These findings have broader implications for understanding bacterial adaptation and survival strategies in diverse ecological niches. By characterizing the methionine transport system, researchers can better understand how Leuconostoc mesenteroides responds to nutritional stress and maintains metabolic homeostasis .

What comparative genomic approaches can reveal the evolutionary relationships of LEUM_1974 across bacterial species?

Comparative genomic analysis reveals:

  • Conservation patterns across Lactobacillales and other bacteria

  • Evolutionary relationships between different transporter families

  • Horizontal gene transfer events in transporter evolution

  • Selection pressures on amino acid transport systems

The distribution of methionine transporters across bacterial taxa reflects both vertical inheritance and horizontal gene transfer events, with specific adaptations to different ecological niches. The evolutionary analysis of LEUM_1974 can be placed within the broader context of T-box regulatory systems across Gram-positive bacteria .

How might research on LEUM_1974 contribute to understanding T-box regulatory mechanisms in bacteria?

LEUM_1974 research provides a model system for studying:

  • T-box regulation of methionine-related genes

  • Coordination between transport and biosynthesis pathways

  • Regulatory RNA structures and their interaction with tRNAs

  • Integration of multiple nutritional signals in metabolic regulation

The T-box antitermination mechanism is a primary regulatory system for amino acid metabolism genes in Gram-positive bacteria. Understanding how this system controls methionine transporter expression can provide broader insights into bacterial adaptation to changing nutritional environments .

What are common challenges in recombinant expression of LEUM_1974 and how can they be addressed?

ChallengeCauseSolution
Inclusion body formationRapid overexpression, improper foldingLower induction temperature (16-20°C), reduce inducer concentration, use solubility-enhancing tags
Low expression levelsCodon bias, toxicity, mRNA stabilityOptimize codon usage, use regulated expression systems, enhance mRNA stability
Proteolytic degradationProtease activity, protein instabilityAdd protease inhibitors, use protease-deficient strains, optimize buffer conditions
Aggregation during purificationHydrophobic interactions, improper foldingOptimize detergent selection, include stabilizing additives, use on-column refolding
Loss of activityDenaturation, cofactor loss, oxidationInclude reducing agents, test different buffer conditions, maintain appropriate metal ions

Systematic troubleshooting of these common challenges is essential for successful recombinant expression and purification of functional LEUM_1974 .

How can expression conditions be optimized when standard protocols fail to yield functional LEUM_1974?

When standard protocols fail, consider these advanced optimization strategies:

  • Alternative expression hosts:

    • Bacillus subtilis for Gram-positive expression

    • Lactococcus lactis for lactic acid bacteria expression

    • Cell-free systems for toxic proteins

  • Fusion partner screening:

    • Test multiple fusion partners (MBP, SUMO, Trx)

    • Position tags at N-terminus, C-terminus, or internal positions

    • Evaluate impact on solubility and function

  • Chaperone co-expression:

    • GroEL/GroES, DnaK/DnaJ/GrpE systems

    • Specialized membrane protein chaperones

  • Expression modulation:

    • Tunable promoters with precise control

    • Induction timing optimization based on growth phase

Strategic application of these approaches can significantly improve success rates with challenging membrane proteins like LEUM_1974 .

What analytical methods are most effective for troubleshooting purification and activity issues with LEUM_1974?

Effective analytical troubleshooting methods include:

  • Protein quality assessment:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Differential scanning fluorimetry for stability evaluation

    • Native PAGE for oligomeric state determination

    • Dynamic light scattering for aggregation detection

  • Functional analysis:

    • ATPase activity assays to verify enzymatic function

    • Substrate binding assays using fluorescence or SPR

    • Reconstitution in nanodiscs for functional studies

  • Structural integrity:

    • Circular dichroism for secondary structure evaluation

    • Limited proteolysis to identify stable domains

    • Mass spectrometry for post-translational modifications

These analytical methods provide critical insights into protein quality, allowing researchers to identify specific issues in the expression and purification pipeline and implement targeted interventions .

How might CRISPR-Cas9 gene editing be applied to study LEUM_1974 function in Leuconostoc mesenteroides?

CRISPR-Cas9 gene editing offers powerful approaches for:

  • Precise genomic modifications:

    • Gene deletion to assess phenotypic consequences

    • Point mutations to test structure-function hypotheses

    • Domain swapping with related transporters

  • Regulatory studies:

    • Promoter modifications to alter expression levels

    • T-box element engineering to manipulate regulation

    • Reporter gene fusions for expression monitoring

  • Systems biology approaches:

    • Multiplexed editing to study transporter redundancy

    • Creation of conditional knockdowns for essential genes

    • Genome-wide screens for functional partners

These genetic manipulation strategies can provide direct insights into LEUM_1974 function within its native cellular context, complementing in vitro studies with recombinant protein .

What emerging technologies might enhance our understanding of LEUM_1974 structure and function?

Emerging technologies with potential impact include:

  • Integrative structural biology:

    • Cryo-electron tomography for in situ structural analysis

    • Mass photometry for single-molecule mass determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Advanced functional assays:

    • Single-molecule FRET for conformational dynamics

    • Microfluidic systems for high-throughput transport assays

    • Nanopore-based single-molecule transport detection

  • Computational approaches:

    • AlphaFold2 structure prediction and refinement

    • Enhanced sampling molecular dynamics for transport mechanisms

    • Deep learning for functional annotation and prediction

These cutting-edge technologies promise to provide unprecedented insights into the structural dynamics and functional mechanisms of LEUM_1974 and related transport systems .

How can systems biology approaches be applied to understand the role of LEUM_1974 in the broader metabolic network?

Systems biology offers integrative approaches to contextualize LEUM_1974 function:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map methionine transport to global metabolic networks

    • Identify regulatory networks controlling transporter expression

  • Metabolic flux analysis:

    • Trace methionine utilization through central metabolism

    • Quantify impact of transporter activity on metabolic fluxes

    • Model adaptive responses to methionine limitation

  • Network modeling:

    • Develop mathematical models of transport kinetics

    • Integrate into genome-scale metabolic models

    • Simulate system responses to environmental perturbations

These approaches place LEUM_1974 function within the broader context of cellular metabolism, providing insights into its role in maintaining methionine homeostasis and supporting essential cellular processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.