Recombinant Leucoraja erinacea Gap junction delta-2 protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Leucoraja erinacea Gap Junction Delta-2 Protein

Recombinant Leucoraja erinacea Gap junction delta-2 protein is a recombinant form of the gap junction delta-2 protein, also known as Connexin-35 (Cx35), derived from the little skate, Leucoraja erinacea. This protein is involved in forming gap junctions, which are crucial for intercellular communication by allowing the direct exchange of ions and small molecules between adjacent cells.

Characteristics of Recombinant Leucoraja erinacea Gap Junction Delta-2 Protein

The recombinant protein is expressed in Escherichia coli and includes a His-tag for purification purposes. It spans the full length of the native protein, comprising 302 amino acids (1-302aa) . The protein is provided in a lyophilized powder form and has a purity of greater than 90% as determined by SDS-PAGE .

Research Findings and Implications

Gap junction delta-2 proteins, including those from Leucoraja erinacea, have been associated with ocular development and refractive errors. Studies in zebrafish have shown that depletion of GJD2 orthologs can lead to changes in ocular biometry and refractive status, suggesting a role in regulating eye development .

Research Highlights:

  • Association with Myopia: The GJD2 gene has been linked to myopia in multiple genome-wide association studies, though functional studies are needed to confirm its role .

  • Zebrafish Studies: Depletion of GJD2 orthologs in zebrafish results in hyperopia and electrophysiological changes in the retina, supporting its role in ocular development .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Gap junction delta-2 protein; Connexin-35; Cx35; Gap junction alpha-9 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Leucoraja erinacea (Little skate) (Raja erinacea)
Target Protein Sequence
MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILVVAIVGETVYDDEQTMFVCNTLQP GCNQACYDKAFPISHIRYWVFQIIMVCTPSLCFITYSVHQSSKQRERQYSTVFITLDKDK KREDNKIKNTTVNGVLQNSEFFTKEMQSDFLEVKEMQNSAARNSKMSKIRRQEGISRFYI IQVVFRNALEIGFLMGQYFLYGFKVPSMYECNRYPCVKMVECYVSRPTEKTVFLVFMFAV SGLCVILNLAELNHLGWRKIKTAVRGAQERRKSIYEIRNKDSPHRIGVPNFGRTQSSDSA YV
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely packed connexon pairs, transmembrane channels that facilitate the diffusion of low-molecular-weight materials between adjacent cells.

Protein Families
Connexin family, Delta-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Retinal specific.

Q&A

What is Gap junction delta-2 protein (GJD2) and what is its primary function in neural tissues?

Gap junction delta-2 protein (GJD2), also known as Connexin-35 (Cx35) in non-mammalian vertebrates and Connexin-36 (Cx36) in mammals, is a transmembrane protein that forms electrical synapses between adjacent neuronal cells. In neural tissues, particularly the retina, GJD2 creates gap junction channels that enable direct electrical coupling and metabolic communication between neurons.

The protein plays a critical role in:

  • Formation of electrical synapses between retinal neurons including photoreceptors, amacrine cells, and ganglion cells

  • Signal averaging and noise reduction in visual processing

  • Synchronization of neuronal networks in the retina

  • Modulation of visual signal transmission

The significance of GJD2 in visual function is highlighted by studies showing its involvement in refractive error development, with altered expression being associated with myopia and hyperopia .

What are the optimal storage and handling conditions for recombinant Leucoraja erinacea GJD2 protein?

Based on manufacturer recommendations and research protocols, optimal handling of recombinant Leucoraja erinacea GJD2 includes:

Storage conditions:

  • Store at -20°C for regular use

  • For extended storage, maintain at -80°C

  • Protein is typically provided in Tris-based buffer with 50% glycerol

  • Working aliquots can be stored at 4°C for up to one week

Handling precautions:

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

  • When working with the N-terminal 10xHis-tagged version, consider potential tag interference in functional assays

  • For reconstitution of lyophilized protein, use gentle agitation rather than vortexing

  • Allow protein to equilibrate to room temperature before opening containers to prevent moisture condensation

These conditions optimize protein stability and functionality for experimental applications.

How can researchers effectively validate the functionality of recombinant GJD2 protein in experimental settings?

Validation of recombinant GJD2 functionality requires multiple complementary approaches:

Structural validation:

  • Western blot analysis using anti-Cx36 antibodies (e.g., mouse anti-Connexin 36 antibody, 1:100 dilution, catalog #36-4600)

  • Immunohistochemistry to confirm proper folding and epitope presentation

  • Size exclusion chromatography to confirm oligomeric state

Functional validation:

  • Electrical coupling assays in transfected cell lines

  • Dye transfer assays using fluorescent tracers to assess gap junction permeability

  • Patch-clamp electrophysiology to measure channel conductance

Application-specific validation:

  • Co-immunoprecipitation with known binding partners

  • Reconstitution into liposomes for biophysical characterization

  • Competitive binding assays with endogenous connexins

When validating antibody specificity against recombinant GJD2, researchers should include appropriate controls, as demonstrated in zebrafish studies where antibody specificity was confirmed using gjd2b−/− tissues alongside wild-type samples .

What evidence links GJD2/Cx36 expression to refractive errors in animal models?

Multiple studies have established a relationship between GJD2/Cx36 expression levels and refractive errors:

In form-deprivation myopia (FDM) guinea pig models:

  • Opaque lens covering for 3 weeks induced significant myopic shift of -6.75D compared to -0.50D in controls

  • Axial length increased by 0.74mm in FDM group vs. 0.10mm in controls

  • GJD2 mRNA expression decreased by 31.58% in the FDM retina

  • Cx36 protein levels reduced by 37.72% in form-deprived eyes

In zebrafish gjd2b/Cx35.1 knockout models:

  • Optical coherence tomography showed reduced eye axial length

  • Hyperopic shifts were observed in adult fish

  • Altered visual-motor behavioral responses to light transitions

  • Morphological changes in head-to-body ratios were documented

This table summarizes key findings from the guinea pig FDM study:

ParameterFDM GroupControl GroupStatistical Significance
Refractive shift-6.75D (-7.94 to -6.31)-0.50D (-0.75 to 0.25)Z = -3.38, P < 0.01
Axial length increase0.74mm (0.61-0.76)0.10mm (0.05-0.21)Z = -3.37, P < 0.01
GJD2 mRNA reduction31.58%Referencet = 11.44, P < 0.01
Cx36 protein reduction37.72%Referencet = 17.74, P < 0.01

These findings collectively suggest that GJD2/Cx36 plays a critical role in ocular development and refractive error regulation across vertebrate species .

How do molecular interactions between GJD2/Cx36 and other signaling pathways influence retinal function?

GJD2/Cx36 interacts with several key signaling pathways in the retina:

Dopaminergic signaling pathway:

  • In zebrafish gjd2b/Cx35.1 knockout models, significant downregulation of dopamine receptors drd3 (0.616-fold, p=0.007) and drd4a (0.657-fold, p<0.001) was observed

  • Vesicular monoamine transporter (vmat2) was upregulated (1.501-fold, p=0.003)

  • These changes suggest compensatory mechanisms in dopaminergic synapses

Wnt/β-catenin signaling:

  • Gjd2b/Cx35.1 deficiency led to downregulation of wnt8b (0.527-fold, p=0.024), wnt11 (0.596-fold, p=0.013), and fdz5 (0.690-fold, p=0.014)

  • This pathway is critical for camera eye development

  • Altered Wnt signaling may contribute to the observed hyperopic phenotype

Regulation of other connexins:

  • Loss of gjd2b/Cx35.1 affected expression of other connexins including reduced gjd1b/Cx34.7 (0.680-fold, p=0.014)

  • Gja3/Cx48.5 (0.608-fold, p=0.022) was also downregulated, potentially affecting lens homeostasis

These interactions demonstrate that GJD2/Cx36 influences retinal function through multiple molecular pathways beyond its direct role in electrical coupling.

What genetic engineering approaches are most effective for studying GJD2 function in animal models?

Several genetic approaches have proven effective for investigating GJD2 function:

CRISPR-Cas9 genome editing:

  • Successfully used to generate gjd2b/Cx35.1-/- zebrafish models

  • Target selection in exon one using E-CRISP tool (www.e-crisp.org)

  • sgRNA (5′-CUCUUAACAGGUAAGGGGGU-3′) targeting a XhoI restriction site

  • Microinjection of Cas9:sgRNA duplex (400 pg) into one-stage embryos

  • Screening via XhoI digestion of PCR amplicons

  • Sanger sequencing of cloned PCR products to confirm mutations

Verification protocols:

  • Primer design for genotyping:

    • Forward: 5′-GGTTCTCTGTGTTACATTCGCCTCC-3′

    • Reverse: 5′-CAATCATAGTAGAGTGCTGTTGGACAGC-3′

  • PCR conditions: initial denaturation at 94°C for 15 min, followed by 38 cycles (94°C for 15s, 58°C for 15s, 72°C for 30s)

Expression analysis:

  • qRT-PCR for transcript quantification

  • Western blot analysis using specific antibodies

  • Immunohistochemistry using anti-Connexin 36 antibody (1:100, catalog #36-4600)

  • Confocal imaging parameters standardized across experimental groups

This methodology has provided functional evidence linking gjd2b/Cx35.1 to refractive error development and altered visual-motor responses.

What are the methodological challenges when working with recombinant GJD2 in functional reconstitution studies?

Researchers face several challenges when reconstituting functional GJD2/Cx36 channels:

Protein solubility and membrane integration:

  • As a transmembrane protein, GJD2 has hydrophobic domains that can lead to aggregation

  • Optimization of detergents and lipid environments is critical

  • Recommended approach: stepwise detergent exchange during purification

Maintaining native oligomeric structure:

  • Gap junction proteins form hexameric connexons (hemichannels)

  • Tag positioning can interfere with oligomerization

  • C-terminal tags are generally preferred over N-terminal tags for functional studies

Functional validation challenges:

  • Traditional electrophysiological methods may be difficult with recombinant proteins

  • Alternative approaches include fluorescent dye transfer assays

  • Reconstitution into liposomes or nanodiscs improves functional assessment

Species-specific considerations:

  • Leucoraja erinacea GJD2 may have different biophysical properties than mammalian Cx36

  • Careful consideration of experimental conditions (pH, calcium concentration) is necessary

  • Channel properties should be compared across species using standardized methodologies

These methodological challenges require careful experimental design and multiple complementary approaches to ensure reliable results in functional studies.

How does Leucoraja erinacea GJD2/Cx35 function compare to its orthologs in zebrafish and mammals?

Comparative analysis reveals both conservation and divergence in GJD2 function across vertebrate lineages:

Structural homology:

  • Leucoraja erinacea (little skate) GJD2/Cx35 maintains the basic connexin topology with four transmembrane domains

  • Zebrafish have four Cx36 orthologs (gjd1a/Cx34.1, gjd1b/Cx34.7, gjd2a/Cx35.5, and gjd2b/Cx35.1)

  • Mammalian Cx36 (encoded by GJD2) has highest sequence similarity to zebrafish gjd2b/Cx35.1

Functional conservation:

  • Across species, GJD2 orthologs form electrical synapses in the retina

  • Expression patterns in retinal neurons are largely conserved

  • Role in visual processing appears consistent from fish to mammals

Divergent features:

  • Leucoraja erinacea GJD2 is also classified as Gap junction alpha-9 in some databases

  • Species-specific differences in regulatory mechanisms and expression patterns exist

  • Zebrafish gjd2b/Cx35.1 knockout produces hyperopia, while reduced GJD2/Cx36 in guinea pigs is associated with myopia

Developmental roles:

  • In zebrafish, gjd2b/Cx35.1 influences head morphology and body proportions

  • Links to Wnt/β-catenin signaling suggest conserved roles in development

  • Species-specific timing of expression may influence developmental outcomes

This evolutionary comparison provides insights into both fundamental and specialized functions of GJD2 across vertebrate lineages.

What experimental approaches can address contradictions in GJD2 function between different animal models?

Reconciling contradictory findings about GJD2 function requires systematic experimental approaches:

Direct head-to-head comparisons:

  • Standardized methodologies across species

  • Identical experimental parameters (age, tissue preparation, analysis methods)

  • Simultaneous processing of samples to minimize technical variation

Species-specific context consideration:

  • Document developmental timing differences

  • Map expression patterns across species using identical antibodies/probes

  • Consider evolutionary distance and genomic context

Resolution strategies for contradictory findings:

  • Molecular compensation analysis: Quantify expression of all connexin family members across species

  • Temporal expression profiling: Analyze GJD2 expression throughout development in each model

  • Circuit-level functional analysis: Compare electrophysiological properties of homologous circuits

  • Pharmacological manipulation: Test response to gap junction modulators across species

  • Interspecies protein substitution: Express Leucoraja GJD2 in mammalian cells and vice versa

Example resolution approach:
The contradictory findings that zebrafish gjd2b/Cx35.1 knockout leads to hyperopia while reduced GJD2/Cx36 in guinea pigs associates with myopia could be addressed by:

  • Creating precise knockouts in both species using identical CRISPR-Cas9 targeting

  • Comprehensive OCT imaging at equivalent developmental timepoints

  • Analysis of all connexin family members to identify compensatory mechanisms

  • Examination of downstream signaling pathways in both models

This systematic approach can help determine whether contradictions reflect true biological differences or methodological variations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.