Recombinant Leucoraja erinacea Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Molecular Classification and Sequence Architecture

Recombinant Leucoraja erinacea (Little skate) rhodopsin is a Class A G protein-coupled receptor (GPCR) belonging to the sensory opsin subfamily . It is expressed recombinantly for structural and functional studies, leveraging its evolutionary conservation among vertebrates.

Phototransduction and Chromophore Binding

Like mammalian rhodopsins, L. erinacea rhodopsin binds 11-cis-retinal via a protonated Schiff base to form the light-sensitive chromophore . Light-induced isomerization to all-trans-retinal triggers conformational changes, activating transducin (Gt) and initiating phototransduction .

Stability and Trafficking

Recombinant expression systems (e.g., COS-1 cells) have been used to study folding and transport. While non-glycosylated bovine opsin retains partial functionality , L. erinacea rhodopsin’s trafficking efficiency in recombinant systems remains uncharacterized.

Pharmacological Chaperones

Studies on human rhodopsin mutants (e.g., P23H) highlight the use of chaperones like YC-001 to rescue misfolded proteins . While L. erinacea rhodopsin is not directly linked to disease models, its structural homology supports its use in:

  • GPCR Dynamics: Investigating TM helix rearrangements during activation .

  • Drug Screening: Testing small-molecule stabilizers for retinal dystrophies .

Comparative Insights and Evolutionary Significance

L. erinacea rhodopsin shares >70% sequence identity with human rhodopsin, particularly in TM regions critical for retinal binding . Key differences include:

  • ECL2 Structure: Lacks the β-sheet "plug" stabilizing 11-cis-retinal in mammals .

  • C-terminal Palmitoylation Sites: Absent in skate rhodopsin, potentially altering membrane anchoring .

Outstanding Research Questions

  1. Glycosylation Impact: Does the absence of conserved glycosylation sites affect folding or stability in recombinant systems?

  2. Trafficking Pathways: How does its trafficking compare to mammalian rhodopsins, given differences in post-translational modifications?

  3. Therapeutic Potential: Can skate rhodopsin serve as a model for designing chaperones targeting Class II RHO mutations ?

Table 2: Comparative GPCR Features

FeatureL. erinacea RhodopsinHuman Rhodopsin
TM Helix Conservation75%100%
ECL2 StructureLinearβ-sheet "plug"
Palmitoylation Sites02 (Cys-322/323)

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Leucoraja erinacea (Little skate) (Raja erinacea)
Target Names
rho
Target Protein Sequence
MNGTEGENFYVPMSNKTGVVRSPFDYPQYYLGEPWMFSALAAYMFFLILTGLPVNFLTLF VTIQHKKLRQPLNYILLNLAVSDLFMVFGGFTTTIITSMNGYFIFGPAGCNFEGFFATLG GEVGLWCLVVLAIERYMVVCKPMANFRFGSQHAIIGVVFTWIMALSCAGPPLVGWSRYIP EGLQCSCGVDYYTMKPEVNNESFVIYMFVVHFTIPLIVIFFCYGRLVCTVKEAAAQQQES ESTQRAEREVTRMVIIMVVAFLICWVPYASVAFYIFINQGCDFTPFFMTVPAFFAKSSAV YNPLIYILMNKQFRNCMITTICLGKNPFEEEESTSASASKTEASSVSSSQVAPA
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor, is crucial for image-forming vision under low light conditions. While most saltwater fish utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the significance of studying Leucoraja erinacea rhodopsin versus other vertebrate rhodopsins?

Leucoraja erinacea rhodopsin represents a unique model for vision research due to several distinctive properties:

Leucoraja erinacea possesses a simplex retina containing exclusively rod photoreceptors, unlike most vertebrates with duplex retinas (containing both rods and cones) . This makes little skate rhodopsin ideal for studying pure rod-based vision without potential confounding effects from cone photoreceptors. Most remarkably, these rod photoreceptors exhibit "functional plasticity," allowing them to adapt to both scotopic (low light) and photopic (bright light) illumination conditions . This adaptation capability is rare, as most vertebrate rods typically function only in dim light conditions.

The functional plasticity extends beyond the photoreceptors themselves, as downstream neurons also adapt across different illumination conditions, continuing to transmit visual information effectively . This makes little skate rhodopsin an excellent model for studying adaptation mechanisms in visual systems.

What structural and functional characteristics define Leucoraja erinacea rod photoreceptors?

Little skate rod photoreceptors exhibit several distinct morphological characteristics:

The rod inner segments are consistently longer than outer segments by approximately 40% (mean of 83μm for inner segments versus 50μm for outer segments) . Inner segments also have greater surface area (mean of 1162μm²) and volume (mean of 1056μm³) compared to outer segments . Unlike typical vertebrate rod outer segments, which have continuous membrane folding with the plasma membrane, Leucoraja erinacea rod outer segments contain stacked internal disks physically separated from the rod outer membrane . This structural arrangement is similar to that found in cones of other species, suggesting a hybrid rod-cone morphology.

The synaptic architecture of little skate rods also shows enhanced connectivity compared to typical vertebrate rods, which may contribute to their functional versatility across light conditions .

How does the Ca²⁺-dependent regulation affect rhodopsin function in photoreceptors?

Calcium plays a critical role in regulating rhodopsin function through calcium-binding proteins like recoverin:

Recoverin mediates calcium-dependent inhibition of rhodopsin phosphorylation, thereby controlling light-triggered phosphodiesterase activity . In high calcium conditions, calcium-bound recoverin (Ca-recoverin) prolongs the recovery phase of bright flash responses by inhibiting rhodopsin deactivation . This regulatory mechanism has an apparent dissociation constant (Kd) for calcium of 13 μM with a Hill coefficient of 2, indicating cooperative binding .

The myristoylation of recoverin significantly increases its regulatory activity (12-fold enhancement), with specific acyl groups (C14:0, C12:0, or C14:2) having similar effects . This calcium-dependent regulation is particularly important at high light levels and may contribute to the ability of Leucoraja erinacea rods to function across diverse light conditions .

What expression systems are most effective for producing recombinant Leucoraja erinacea rhodopsin?

Based on research practices with rhodopsins from other species, several expression systems can be adapted for Leucoraja erinacea rhodopsin:

Mammalian Cell Systems:

  • HEK293 cells provide proper post-translational modifications and membrane targeting

  • COS-7 cells offer high transfection efficiency and protein expression

  • Both systems should be cultured at lower temperatures (28-32°C) during expression to optimize proper folding

Insect Cell Systems:

  • Sf9 or High Five cells using baculovirus expression vectors

  • Superior for large-scale production with proper membrane protein folding

The expression construct should include:

  • The complete Leucoraja erinacea rhodopsin coding sequence

  • A purification tag (His6 or 1D4 epitope) positioned to minimize interference with function

  • A specialized promoter for controlled expression levels to prevent aggregation

What are the critical considerations for stabilizing and purifying Leucoraja erinacea rhodopsin?

Rhodopsin is a light-sensitive membrane protein requiring specific stabilization conditions:

Stabilization During Purification:

  • All procedures must be performed under dim red light to prevent photoactivation

  • Include appropriate detergents (n-dodecyl-β-D-maltoside or digitonin) for membrane extraction

  • Maintain low temperature (4°C) throughout purification

  • Include protease inhibitors to prevent degradation

Buffer Optimization:

  • pH range of 6.5-7.5 to maintain native conformation

  • Include stabilizing agents such as glycerol (10-15%)

  • Add 11-cis-retinal during purification to ensure proper chromophore binding

  • Consider adding specific lipids to maintain rhodopsin stability

The functional plasticity observed in native Leucoraja erinacea rhodopsin suggests specialized stabilization requirements may be necessary to preserve this property in the recombinant protein.

What spectroscopic methods are most appropriate for characterizing Leucoraja erinacea rhodopsin?

Several complementary techniques provide comprehensive characterization:

UV-Visible Absorption Spectroscopy:

  • Measure absorbance spectra (250-650 nm) to confirm chromophore binding

  • Determine λmax (expected around 500 nm, may differ from mammalian rhodopsins)

  • Monitor photobleaching kinetics upon light exposure

  • Assess thermal stability by tracking absorbance changes over time at various temperatures

Circular Dichroism (CD) Spectroscopy:

  • Far-UV CD (190-250 nm) to assess secondary structure composition

  • Near-UV CD (250-350 nm) to evaluate tertiary structure integrity

  • Monitor structural changes during light activation

Fluorescence Spectroscopy:

  • Tryptophan fluorescence to monitor conformational changes

  • FRET-based assays to investigate rhodopsin-transducin interactions

For investigating the functional plasticity characteristic of Leucoraja erinacea photoreceptors , combining spectroscopic measurements with varying calcium concentrations may reveal insights into the mechanisms underlying adaptation to different light conditions.

How can researchers investigate the signaling properties of recombinant Leucoraja erinacea rhodopsin?

Several methodologies enable detailed characterization of rhodopsin signaling:

G Protein Activation Assays:

  • GTPγS binding assays to measure transducin activation rates

  • Fluorescence-based FRET assays for real-time activation kinetics

  • Compare activation under various calcium concentrations to assess functional plasticity

Phosphorylation Analysis:

  • In vitro rhodopsin kinase assays with purified GRK1

  • Monitor phosphorylation in the presence of varying calcium and recoverin concentrations

  • Investigate if the calcium-dependent inhibition of rhodopsin phosphorylation observed with other rhodopsins occurs similarly with Leucoraja erinacea rhodopsin

Arrestin Binding Studies:

  • Surface plasmon resonance to measure binding kinetics

  • Pull-down assays to assess binding under different phosphorylation states

These techniques can help determine if Leucoraja erinacea rhodopsin signaling properties contribute to the observed functional plasticity of its photoreceptors across scotopic and photopic conditions .

How does Leucoraja erinacea rhodopsin compare structurally and functionally with other vertebrate rhodopsins?

Comparative analysis provides insights into evolutionary adaptations:

Sequence Comparison:

SpeciesSequence Identity (%)Key Differences
Human~80-85 (estimated)Differences likely in cytoplasmic loops and C-terminus
Bovine~80-85 (estimated)Variations in G-protein interaction domains
Zebrafish~75-80 (estimated)Differences in transmembrane regions
Salamander~75-80 (estimated)Variations in chromophore pocket residues

Functional Differences:

  • Photochemical cycle kinetics may be adapted for the functional plasticity observed in Leucoraja erinacea rods

  • The calcium-dependent regulation via recoverin may show different sensitivity compared to other species

  • The ability to function in both scotopic and photopic conditions suggests unique regulatory mechanisms

The hybrid rod-cone morphology observed in Leucoraja erinacea photoreceptors may be reflected in rhodopsin properties that combine aspects of both typical rod and cone visual pigments.

What insights can comparative genomics provide about Leucoraja erinacea rhodopsin evolution?

The recent sequencing of the little skate genome provides opportunities for evolutionary analysis:

The little skate genome assembly enables identification of rhodopsin gene regulatory elements that may explain the unique expression patterns in the simplex retina. Comparative analysis of rhodopsin gene sequences and surrounding regulatory regions across vertebrate species can reveal evolutionary adaptations related to the development of rod photoreceptors with functional plasticity.

Transcriptomic analysis of Leucoraja erinacea retina can identify co-expressed genes involved in the rhodopsin signaling pathway that may contribute to the unusual functional plasticity of these rod photoreceptors.

What are the primary challenges in working with recombinant Leucoraja erinacea rhodopsin?

Several technical challenges must be addressed:

Expression Challenges:

  • Low expression yields common with membrane proteins

  • Potential misfolding and aggregation

  • Incomplete chromophore incorporation

Solution Approaches:

  • Optimize codon usage for the expression system

  • Use inducible promoters with careful temperature control

  • Include chemical chaperones during expression

  • Co-express with molecular chaperones to improve folding

Functional Assay Challenges:

  • Maintaining functional properties after purification

  • Developing assays that capture the unique functional plasticity

  • Preventing light-induced activation during handling

Solution Approaches:

  • Use stabilizing lipid compositions that mimic native environment

  • Develop specialized instrumentation for measuring responses across different light intensities

  • Establish strict light control protocols using appropriate filters

How can researchers verify that recombinant Leucoraja erinacea rhodopsin maintains its native properties?

Verification requires multiple complementary approaches:

Biochemical Verification:

  • Spectroscopic properties should match those of native rhodopsin

  • Glycosylation and other post-translational modifications should be assessed

  • Ligand binding properties should be comparable to native protein

Functional Verification:

  • Light-dependent conformational changes should occur with appropriate kinetics

  • G-protein activation capabilities should be preserved

  • Response to calcium regulation through recoverin should be maintained

Structural Verification:

  • Circular dichroism spectroscopy to confirm proper secondary structure

  • Limited proteolysis patterns compared to native protein

  • If possible, structural determination through crystallography or cryo-EM

Testing the recombinant protein's response across different calcium concentrations would be particularly important to verify if it maintains the functional plasticity observed in native Leucoraja erinacea photoreceptors .

How can Leucoraja erinacea rhodopsin contribute to understanding retinal diseases?

The unique properties of little skate rhodopsin offer valuable insights for disease research:

Rhodopsin mutations are associated with retinal disorders including retinitis pigmentosa (RP) and congenital stationary night blindness (CSNB) . The functional plasticity of Leucoraja erinacea rhodopsin provides a unique model for understanding how photoreceptors can adapt to changing light conditions, which may inform therapeutic strategies for retinal diseases.

Comparative studies between Leucoraja erinacea rhodopsin and disease-causing mutant human rhodopsins could reveal compensatory mechanisms that enable functional adaptation. The calcium-dependent regulation of rhodopsin function may be particularly relevant for understanding disease mechanisms, as calcium homeostasis is often disrupted in retinal degenerative conditions.

What novel experimental approaches can be developed using recombinant Leucoraja erinacea rhodopsin?

The unique properties of little skate rhodopsin enable innovative research approaches:

Optogenetic Applications:

  • Development of modified rhodopsins with enhanced functional range across light conditions

  • Creation of optogenetic tools that function in both low and high light environments

  • Design of rhodopsin variants with specialized calcium sensitivity

Biosensor Development:

  • Engineering calcium-sensitive rhodopsin-based biosensors

  • Developing light-responsive systems that function across wide illumination ranges

  • Creating novel tools for studying G-protein coupled receptor signaling

Structural Biology Platforms:

  • Using the potentially enhanced stability of Leucoraja erinacea rhodopsin for structural studies

  • Developing expression systems optimized for membrane proteins with complex regulation

  • Creating chimeric proteins combining domains from different rhodopsins to understand function

The research potential is enhanced by the recent sequencing of the little skate genome , which provides additional genetic resources for rhodopsin engineering and comparative studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.