Recombinant Ligand-gated ion channel 50 (lgc-50)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Structure:

  • LGC-50 comprises 491 amino acids with four transmembrane domains (M1–M4) and a large intracellular loop between M3 and M4 (M3/4 loop) .

  • Sequence identity with MOD-1 (another serotonin-gated LGIC) is 47% outside the M3/4 loop but drops to 15% within this regulatory domain .

Key Domains:

  • The M3/4 loop contains phosphorylation sites (S335, T348, S353) and motifs regulating membrane trafficking .

  • Unlike anion-selective LGICs, LGC-50 lacks the "PAR" motif, instead possessing a serine residue critical for cation selectivity .

Ion Selectivity and Activation

PropertyValue/DescriptionSource
Ion selectivityCationic (Na⁺ > K⁺)
Primary ligandSerotonin (EC₅₀ = 17.5 µM)
Current amplitude15 nA (wild-type) → 2.6 µA (M3/4 chimera)
Reversal potential-43 mV in Na⁺-free conditions

Trafficking Regulation

  • The M3/4 loop suppresses surface expression:

    • Replacing LGC-50’s M3/4 loop with MOD-1’s increased currents by 175× .

    • Deleting residues 363–379 in the M3/4 loop enhanced membrane localization .

  • Phosphorylation at S335, T348, and S353 modulates trafficking efficiency .

Role in Aversive Olfactory Learning

Mechanism:

  • LGC-50 is required for learned avoidance of pathogenic bacteria (e.g., Serratia marcescens) .

  • Pathogen exposure redistributes LGC-50 to synaptic processes in RIA interneurons, which are critical for olfactory steering .

Genetic Evidence:

  • lgc-50 mutants fail to associate pathogen odors with aversive stimuli .

  • Rescue experiments restoring lgc-50 expression in RIA neurons fully rescue learning deficits .

Interaction Partners

LGC-50 forms functional networks with other LGICs and receptors :

ProteinFunctional AssociationScore
LGC-25Neuronal signaling (Neur_chan_LBD domain)0.796
LGC-23Ligand-gated ion channel0.721
SER-4G-protein coupled receptor0.498

Research Findings and Implications

  • Synaptic Plasticity: LGC-50 trafficking to synapses is activity-dependent, linking receptor localization to behavioral adaptation .

  • Disease Relevance: Regulated LGIC trafficking is conserved in mammals, suggesting parallels in neuropsychiatric disorders .

  • Tool Development: Chimeric LGC-50/MOD-1 receptors enable studies of ion channel engineering .

Open Questions

  • How do phosphorylation events in the M3/4 loop recruit trafficking machinery?

  • Does LGC-50 interact with metabotropic serotonin receptors to modulate learning?

  • Can LGC-50’s cation selectivity be exploited for optogenetic applications?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this preference in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C is recommended. Our default glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgc-50; T20B12.9; Ligand-gated ion channel 50
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-476
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
lgc-50
Target Protein Sequence
MGFFFEYLEFNSRINLGKLIDTLLTDYDTHLLPEAEGVNVTIELHVQGVSGISEITGDFS LDVMYSEIWQDPRLSFKHLNVCATNITLKVSDFRKKIWTPDTCIINSKSSSIHSSPSENT FVILYENGLVWSNFRLNVKTPCSVNLKMFPFDSLSCEIVLESYSFNTDEVRLMWHDVPIT MMEKVELPDFDLIGWSTDHQRLEYPNGIWDRAKVKFTFARRYGFYLFQSYFPTSLTVISS WVGFFFDVRSVSARITLGVSSLLALTFQFGNVLRHLPRVSYIKCLDVWMIFSVIFIFCTL VELAIVCQLNRWERERQIGSKVLGHWLNQIRKTRKKESKADEGGGGGVGGLLRKRIPVLA QLKAAATDSNSGAATAMTTAIQPPNTNLNSITNSDNSKLVANNFTSIEHETYAYEKKRGF SHCFQRFVYAICPPDRDWTITSVQVDRCSMIMFPLSFLIFNVVYWSIYFMKMDRPM
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_T20B12.9

STRING: 6239.T20B12.9

UniGene: Cel.10015

Protein Families
Ligand-gated ion channel (TC 1.A.9) family
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is LGC-50 and what is its basic function?

LGC-50 is a pentameric ligand-gated ion channel (LGIC) found in C. elegans that functions as a serotonin-gated cation channel. It belongs to the Cys-loop family of LGICs that play critical roles in fast synaptic transmission. Research has demonstrated that LGC-50 is essential for aversive olfactory learning, particularly in learned olfactory avoidance of pathogenic bacteria, a process known to depend on serotonergic neurotransmission . LGC-50 is expressed in neurons postsynaptic to aminergic neurons, specifically in the RIA neurons known to be critical for serotonin-dependent pathogen avoidance learning .

How was LGC-50 initially deorphanized?

LGC-50 was deorphanized through systematic characterization of orphan channels from C. elegans. Researchers generated cDNA clones of 5 orphan LGC genes in the putative monoamine-gated group, including lgc-50. These were heterologously expressed in Xenopus oocytes, and two-electrode voltage clamp recordings were used to measure channel activity in response to a panel of 11 potential neurotransmitters and neuromodulators. LGC-50 was found to be specifically gated by serotonin (5-HT) with an EC₅₀ of 0.94 μM, as well as by the 5-HT metabolite tryptamine .

What are the most effective methods for heterologous expression of LGC-50?

For functional studies of LGC-50, heterologous expression in Xenopus oocytes has been successfully employed, followed by two-electrode voltage clamp recordings to characterize channel activity . When working with recombinant LGC-50:

  • Expression System Selection: While Xenopus oocytes are preferred for electrophysiological characterization, E. coli has been used for protein production for biochemical and structural studies .

  • Construct Optimization: Including a His-tag at the N-terminus can facilitate purification without significantly affecting function .

  • M3/M4 Loop Consideration: Research has shown that the M3/M4 intracellular loop of LGC-50 contains domains that restrict plasma membrane trafficking. Creating chimeric receptors by exchanging the M3/M4 loop of LGC-50 with that of MOD-1 resulted in a 175-fold increase in peak current, suggesting improved membrane localization .

  • Storage Conditions: For recombinant LGC-50 protein, store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use. Avoid repeated freeze-thaw cycles. Reconstitution should be done in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol recommended for long-term storage .

What electrophysiological techniques are most suitable for studying LGC-50 function?

Several electrophysiological approaches can be applied to study LGC-50 function:

  • Two-Electrode Voltage Clamp: This technique has been successfully used to characterize LGC-50 in Xenopus oocytes, allowing for the determination of ligand sensitivity (EC₅₀) and ion selectivity .

  • Whole-Cell and Excised Patch Recordings: These techniques are applicable to studying the effects of externally and internally applied agents on LGC-50 behavior .

  • Microfluidic Chip-Based Techniques: Recent advances include microfluidic chip-based methods for studying ion currents and fluorescence signals in either excised membrane patches or whole cells. This approach allows for:

    • Measuring activation and deactivation kinetics

    • Determining ligand binding and unbinding using confocal patch-clamp fluorometry

    • Producing unidirectional concentration-activation relationships at or near equilibrium

    • Minimizing run-down phenomena and desensitization effects due to short measuring periods

What are the recommended protocols for studying LGC-50 trafficking and localization?

To investigate LGC-50 trafficking and localization, several approaches have been employed:

  • GFP Tagging for In Vivo Localization: Transgenic animals expressing GFP-tagged LGC-50 protein from the lgc-50 locus can be used to visualize the subcellular distribution of LGC-50 .

  • M3/M4 Loop Manipulation: The M3/M4 intracellular loop appears crucial for receptor trafficking. Creating chimeric constructs by exchanging the M3/M4 loop between LGC-50 and other channels (such as MOD-1) can provide insights into trafficking mechanisms .

  • Point Mutation Analysis: Specific point mutations in LGC-50 have been shown to cause misregulation of receptor membrane expression. Introducing these mutations can help identify critical residues involved in trafficking .

  • Conditioning Experiments: Since the expression of LGC-50 in neuronal processes is enhanced by olfactory conditioning, experimental protocols involving pathogen exposure can be used to study activity-dependent changes in receptor localization .

How does LGC-50 contribute to neural circuit function in C. elegans?

LGC-50 functions as one of three core serotonin receptors (alongside MOD-1 and SER-4) that induce slow locomotion upon serotonin stimulation in C. elegans . The functional organization of this system has been mapped at both single neuron and whole-brain levels.

Recent research using optogenetic activation of serotonergic NSM neurons combined with genetic analysis has revealed distinct roles for these receptors:

ReceptorTypePrimary FunctionSpeed Change Profile During NSM::Chrimson Activation
LGC-50Serotonin-gated cation channelMediates slow locomotionShows intensity-dependent response to stimulation
MOD-1Serotonin-gated chloride channelMediates slow locomotionMore sensitive at medium-intensity stimulation compared to LGC-50
SER-4Metabotropic serotonin receptorMediates slow locomotionDistinct response profile at medium vs. high-intensity stimulation

These three receptors appear to work in concert, with genetic analysis showing that animals expressing only one receptor type still show slowing responses, but with altered dynamics and intensity dependencies .

What is the relationship between LGC-50 membrane expression and learning mechanisms?

Research has established a critical link between LGC-50 membrane expression and learning mechanisms in C. elegans:

  • Activity-Dependent Redistribution: The expression of LGC-50 in neuronal processes is enhanced by olfactory conditioning, suggesting that receptor redistribution is a key component of learning .

  • Trafficking Regulation: The M3/M4 intracellular loop of LGC-50 contains domains that can restrict plasma membrane trafficking. Experimental manipulation of this region dramatically affects receptor surface expression .

  • Point Mutations and Learning Defects: Point mutations in LGC-50 that cause misregulation of receptor membrane expression interfere with olfactory learning, directly linking proper trafficking and localization to learning capability .

  • Specific Learning Role: LGC-50 mutants show a specific defect in learned olfactory avoidance of pathogenic bacteria but retain normal chemotaxis to attractive odors and innate avoidance of repellent odors. This indicates that LGC-50 is specifically required for experience-dependent plasticity rather than basic sensory processing .

These findings suggest that the regulated trafficking and synaptic localization of LGC-50 represent a molecular cornerstone of learning mechanisms in C. elegans .

How do LGC-50 function and genetic disruptions correlate with behavioral phenotypes?

The correlation between LGC-50 function and behavioral phenotypes has been characterized through various genetic approaches:

  • Knockout Studies: lgc-50 mutants show specific defects in learned olfactory avoidance of pathogenic bacteria, a process known to depend on serotonergic neurotransmission. This indicates that LGC-50 is essential for this form of learning .

  • Expression Pattern Analysis: LGC-50 is expressed in the RIA neurons, which are known to be critical for serotonin-dependent pathogen avoidance learning. This expression pattern correlates with the behavioral deficit seen in lgc-50 mutants .

  • Locomotion Studies: Comprehensive genetic analyses have identified LGC-50 as one of three core serotonin receptors (alongside MOD-1 and SER-4) that induce slow locomotion upon serotonin stimulation. Speed changes during NSM::Chrimson activation reveal distinct but overlapping roles for these receptors in modulating locomotion .

  • Point Mutation Effects: Point mutations in LGC-50 that cause misregulation of receptor membrane expression interfere with olfactory learning, establishing a direct link between receptor trafficking/localization and behavioral output .

What is the functional relationship between LGC-50 and other serotonin receptors in C. elegans?

Research has revealed complex interactions between LGC-50 and other serotonin receptors in C. elegans:

  • Core Receptor Triad: Comprehensive genetic analyses have identified three core serotonin receptors (MOD-1, SER-4, and LGC-50) that work together to induce slow locomotion upon serotonin stimulation .

  • Distinct Receptor Properties:

    • LGC-50: Serotonin-gated cation channel

    • MOD-1: Serotonin-gated chloride channel

    • SER-4: Metabotropic serotonin receptor

  • Functional Redundancy and Specialization: Speed decay rates back to baseline after maximal slowing show differences between wild-type animals and various receptor mutants. Animals expressing only a single receptor type still show slowing responses, but with altered dynamics .

  • Stimulus Intensity Differentiation: Different receptors show varying sensitivity to stimulus intensity. For example, SER-4-only expressing animals show significant differences between medium and high-intensity stimulation, while MOD-1 appears more sensitive at medium-intensity stimulation compared to LGC-50 .

  • Neural Circuit Integration: The three receptors act on partially overlapping but distinct sets of neurons within the C. elegans connectome, allowing for complex integration of serotonergic signals at the circuit level .

What are common difficulties in achieving functional expression of LGC-50 and how can they be overcome?

Several challenges may be encountered when working with LGC-50:

  • Poor Membrane Localization: The M3/M4 intracellular loop of LGC-50 contains domains that restrict plasma membrane trafficking, resulting in low functional expression.

    • Solution: Creating chimeric constructs by exchanging the M3/M4 loop of LGC-50 with that of better-expressing channels (such as MOD-1) can significantly improve surface expression. A LGC-50:MOD-1 (327-458) chimeric receptor showed a 175-fold increase in peak current relative to native LGC-50 .

  • Protein Stability Issues:

    • Solution: Adding 5-50% glycerol to storage buffer can enhance stability. Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week .

  • Signal Detection Challenges in Electrophysiology:

    • Solution: Given the relatively small currents produced by native LGC-50, using more sensitive recording techniques or chimeric constructs with improved expression can enhance signal detection .

  • Rapid Desensitization:

    • Solution: Microfluidic chip-based techniques that allow for rapid solution exchange and short measuring periods can minimize desensitization effects .

What considerations should be made when designing mutagenesis studies of LGC-50?

When designing mutagenesis studies of LGC-50, consider the following:

  • Functional Domains: Target specific domains with known or predicted functions:

    • M3/M4 Loop: Critical for trafficking and subject to regulation during learning

    • Ligand-Binding Domain: Alterations may affect serotonin sensitivity or specificity

    • Ion Selectivity Filter: Modifications can alter channel conductance or ion selectivity

  • Trafficking vs. Function: Distinguish between mutations affecting trafficking and those affecting channel function:

    • Use chimeric constructs with reporters to assess membrane localization

    • Combine with electrophysiological measurements to evaluate channel function

  • Behavioral Assessment: Correlate molecular changes with behavioral effects:

    • Learning Paradigms: Test olfactory learning using pathogen avoidance assays

    • Locomotion Assays: Measure changes in serotonin-induced locomotion effects

  • In Vivo Validation: Ensure mutations introduced in heterologous systems are validated in vivo:

    • Use CRISPR/Cas9 to generate equivalent mutations in C. elegans

    • Assess both molecular (localization, trafficking) and behavioral consequences

How can researchers address data discrepancies between in vitro and in vivo LGC-50 studies?

Data discrepancies between in vitro and in vivo studies of LGC-50 are common and may be addressed through several strategies:

  • Context-Dependent Expression: In vitro systems may lack regulatory factors present in vivo:

    • Use more complex expression systems that better recapitulate the native cellular environment

    • Consider co-expression with interacting proteins identified in vivo

  • Post-Translational Modifications: These may differ between systems:

    • Analyze post-translational modifications in native vs. recombinant LGC-50

    • Introduce mutations that mimic or prevent specific modifications

  • Receptor Trafficking Differences: The native cellular machinery for receptor trafficking may be absent in heterologous systems:

    • Study trafficking in neuronal cell cultures that more closely resemble the native environment

    • Use fluorescent protein tags to monitor receptor localization in both systems

  • Stoichiometry and Assembly: Pentameric LGICs may assemble differently in different systems:

    • Employ techniques to determine subunit stoichiometry and assembly in both contexts

    • Consider co-expression with other subunits that might form heteromeric channels in vivo

  • Functional Environment Differences: The lipid environment, interacting proteins, and signaling pathways differ between systems:

    • Use lipid reconstitution approaches for in vitro studies

    • Employ optogenetic or chemogenetic approaches in vivo to isolate specific channel functions

What are promising approaches for developing selective modulators of LGC-50?

The development of selective modulators for LGC-50 represents an important frontier for research:

  • Structure-Based Drug Design: Although the crystal structure of LGC-50 has not been reported, homology modeling based on related LGICs could guide the design of selective modulators.

  • High-Throughput Screening: Utilizing the LGC-50:MOD-1 M3/M4 loop chimera with enhanced expression levels could facilitate the development of fluorescence-based or electrophysiological screening assays for compound libraries.

  • Allosteric Modulation: Targeting unique allosteric sites rather than the orthosteric serotonin-binding site may yield greater selectivity across serotonin receptors.

  • Biased Modulation: Developing compounds that selectively affect specific aspects of channel function (e.g., activation vs. desensitization) could provide more nuanced tools for research.

  • In Vivo Validation Pipeline: Establishing a pipeline for rapid testing of compounds in C. elegans behavioral assays would accelerate the development of functionally relevant modulators.

How might advanced imaging techniques further elucidate LGC-50 dynamics in neural circuits?

Advanced imaging techniques offer promising avenues for understanding LGC-50 dynamics:

  • Super-Resolution Microscopy: Techniques such as STORM or PALM could reveal nanoscale organization of LGC-50 at synapses and how this changes during learning.

  • Single-Molecule Tracking: This approach could provide insights into the mobility, clustering, and internalization dynamics of LGC-50 in live neurons.

  • Optogenetic Tagging: Combining optogenetic activation of serotonergic neurons with fluorescent reporters of LGC-50 localization could reveal real-time receptor redistribution during signaling.

  • Calcium Imaging with Receptor Visualization: Simultaneous imaging of LGC-50 localization and calcium transients could connect receptor distribution to functional neural activity.

  • Whole-Brain Imaging: Building on recent advances in whole-brain imaging in C. elegans , researchers could map the distribution and activation patterns of LGC-50-expressing neurons throughout the entire nervous system.

What comparative studies between LGC-50 and mammalian serotonin-gated ion channels would be most informative?

Comparative studies between LGC-50 and mammalian serotonin receptors could yield important insights:

  • Phylogenetic Analysis: Comprehensive phylogenetic analysis could reveal evolutionary relationships between LGC-50 and mammalian serotonin receptors, particularly the 5-HT3 receptor which is also a ligand-gated ion channel.

  • Functional Conservation: Testing whether mammalian neurons expressing LGC-50 respond to serotonin in ways that recapitulate aspects of endogenous serotonin signaling could reveal conserved signaling mechanisms.

  • Structural Comparisons: Comparing the structural basis of serotonin binding and channel gating between LGC-50 and 5-HT3 receptors could identify conserved and divergent mechanisms.

  • Trafficking Regulation: Investigating whether the trafficking mechanisms identified for LGC-50 apply to mammalian serotonin receptors could reveal conserved regulatory pathways.

  • Learning Mechanisms: Testing whether the activity-dependent changes in LGC-50 expression have parallels in mammalian systems could identify conserved molecular mechanisms underlying learning and memory.

  • Cross-Species Rescue Experiments: Determining whether mammalian serotonin receptors can rescue the behavioral deficits of lgc-50 mutants would test functional conservation across species.

What are the most important considerations for researchers new to LGC-50 studies?

Researchers beginning work with LGC-50 should consider:

  • Expression System Selection: Be aware that native LGC-50 shows limited functional expression. Consider using the LGC-50:MOD-1 M3/M4 loop chimera for improved expression in heterologous systems .

  • Multidisciplinary Approach: Combine molecular, electrophysiological, and behavioral methods for comprehensive characterization.

  • Genetic Background Control: When studying LGC-50 in C. elegans, careful control of genetic background is essential as other serotonin receptors (MOD-1, SER-4) may compensate for LGC-50 loss .

  • Learning Paradigm Selection: For behavioral studies, the pathogen avoidance learning paradigm is most reliably affected by LGC-50 manipulation .

  • Storage and Handling: For recombinant protein, follow proper storage protocols (aliquoting, avoiding freeze-thaw cycles) to maintain functionality .

What standardized protocols should be established for consistent LGC-50 research across laboratories?

To ensure consistency in LGC-50 research across laboratories, the following standardized protocols are recommended:

  • Expression Constructs: Establish a repository of validated expression constructs, including the LGC-50:MOD-1 M3/M4 loop chimera for improved expression.

  • Electrophysiology Protocols: Standardize voltage-clamp protocols, including holding potentials, solution compositions, and data analysis methods.

  • Behavioral Assays: Develop detailed protocols for pathogen avoidance learning assays, including standardized bacterial strains, training durations, and quantification methods.

  • Imaging Approaches: Establish consensus methods for quantifying LGC-50 localization and trafficking in neurons, including standardized regions of interest and normalization procedures.

  • Reporting Requirements: Implement minimum reporting standards for experimental conditions, genetic backgrounds, and technical parameters to ensure reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.