Recombinant Lilium longiflorum Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (CCAMK)

Shipped with Ice Packs
In Stock

Description

Overview of CCAMK

Calcium/calmodulin-dependent protein kinase (CCaMK) is a serine/threonine-protein kinase that is unique to plants . Lilium longiflorum CCaMK (LlCCaMK) shares high sequence homology with CaMKII found in mammals, particularly in the kinase and CaM-binding domains . The full-length cDNA of DoCCaMK is 2071 bp long . The Lilium longiflorum CCaMK (Patil et al., 1995) has been characterized .

Structure and Properties

Lilium longiflorum CCaMK is a protein that consists of 520 amino acids . As deduced by Compute pI/MW, DoCCaMK has 514 amino acids, its isoelectric point is 5.92, and its molecular weight is 57.51 kDa . CCaMK contains several key domains :

  • An N-terminal Ser-Thr kinase domain

  • An autoinhibitory domain

  • A CaM-binding domain

  • A C-terminal neural visinin-like domain with three EF hands

Expression and Localization

CCaMK expression is significantly upregulated after symbiosis with Sebacina sp . The DoCCaMK-GFP protein localized in the nucleus and cell membrane .

Regulation of CCaMK

CCaMK is regulated by calcium in both negative and positive manners, creating a molecular switch sensitive to calcium concentrations associated with basal states and oscillations .

  • Autophosphorylation: Calcium binding to the EF-hand domains promotes autophosphorylation, which negatively regulates CCaMK by stabilizing the inactive state of the protein .

  • Calmodulin Binding: Calcium-dependent CaM binding overrides the effects of autophosphorylation and activates the protein . The differential calcium binding affinities of the EF-hand domains compared with those of CaM suggest that CCaMK is maintained in the inactive state at basal calcium concentrations and is activated via CaM binding during calcium oscillations .

Function

CCaMK is involved in several pathways and plays different roles in them . CIP73 transcripts are preferentially expressed in roots, and very low expression is detected in leaves, stems, and nodules . The expression in roots is significantly decreased after inoculation of Mesorhizobium loti . RNA interference knockdown of CIP73 expression by hairy root transformation in Lotus japonicus led to decreased nodule formation, suggesting that CIP73 performed an essential role in nodulation .

Interactions

CCaMK interacts with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays . The amino-terminal 80 amino acid residues (80–160) of CCaMK are required for interacting with CIP73 in yeast cells . Protein pull-down assay and bimolecular fluorescence complementation assay in Nicotiana benthamiana show that the full-length CCaMK could interact with CIP73 in vitro and in planta . CCaMK phosphorylates the amino terminus of CIP73 in a Ca2+/calmodulin-dependent manner in vitro .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CCAMK; Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase; LlCCaMK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-520
Protein Length
full length protein
Species
Lilium longiflorum (Trumpet lily)
Target Names
CCAMK
Target Protein Sequence
MSRHESRKLSDDYEVVDVLGKGGFSVVRRGISKSRGKNNDVAIKTLRRYGYTLPGAQRSQ PGQRGLSPLGMPTLKQVSVSDALLTNEILVMRRIVEDVSPHPNVIHLHDVYEDANGVHLV LELCSGGELFDRIVAQDRYSESEAAEVVQQIASGLAALHKSTIIHRDLKPENCLFLNQEK RSTLKIMDFGLSSVEDFTDPIVALFGSIDYVSPEALSQRQVSSASDMWSLGVILYILLSG CPPFHAPSNREKQQRILAGDFSFEEHTWKTITSSAKDLISSLLSVDPYKRPTANDLLKHP WVIGDSAKQELIEPEVVSRLRSFNARRKLRAAAIASVLSSKVLLRTKKLKNLLGSHDMKS EELENLRAHFKRICANGDNATLPEFEEVLKAMKMNSLIPLAPRVFDLFDNNRDGTIDMRE ILCGLSNLRNSQGDDALQLCFQMYDADRSGCISKEELASMLRALPEDCVPADITEPGKLD EIFDQMDANSDGVVTFDEFKAAMQRDSSLQDVVLSSLRTI
Uniprot No.

Target Background

Function
A protein kinase potentially involved in microsporogenesis.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.