Recombinant Limnanthes alba 1-acyl-sn-glycerol-3-phosphate acyltransferase

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
1-acyl-sn-glycerol-3-phosphate acyltransferase; 1-AGP acyltransferase; 1-AGPAT; Lysophosphatidic acid acyltransferase; LPAAT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Limnanthes alba (White meadowfoam)
Target Protein Sequence
MAKTRTSSLRNRRQLKTAVAATADDDKDGIFMVLLSCFKIFVCFAIVLITAVAWGLIMVL LLPWPYMRIRLGNLYGHIIGGLVIWLYGIPIEIQGSEHTKKRAIYISNHASPIDAFFVMW LAPIGTVGVAKKEVIWYPLLGQLYTLAHHIRIDRSNPAAAIQSMKEAVRVITEKNLSLIM FPEGTRSGDGRLLPFKKGFVHLALQSHLPIVPMILTGTHLAWRKGTFRVRPVPITVKYLP PINTDDWTVDKIDDYVKMIHDIYVRNLPASQKPLGSTNRSK
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acylating the 2-position using erucoyl-CoA as the acyl donor.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Limnanthes alba 1-acyl-sn-glycerol-3-phosphate acyltransferase and what is its biological function?

Limnanthes alba (white meadowfoam) 1-acyl-sn-glycerol-3-phosphate acyltransferase (LPAAT) is an enzyme that catalyzes the acylation of lysophosphatidic acid (LPA), producing phosphatidic acid (PA). This reaction represents a critical step in the de novo biosynthesis pathway of membrane glycerophospholipids. The enzyme belongs to the LPAAT family (also known as 1-AGP acyltransferase, 1-AGPAT, or lysophosphatidic acid acyltransferase) and specifically mediates the acylation at the sn-2 position of the glycerol backbone . In the context of plant lipid metabolism, this enzyme contributes to the production of phospholipids and triacylglycerols (TAGs), which serve as essential membrane components and storage lipids, respectively. The Limnanthes alba enzyme has evolutionary adaptations that influence its substrate preferences, making it particularly interesting for researchers studying plant lipid metabolism and biotechnology applications .

How is recombinant Limnanthes alba LPAAT typically expressed and what expression systems are most effective?

Recombinant Limnanthes alba LPAAT is typically expressed using bacterial expression systems, with Escherichia coli being the predominant host. The full-length protein (281 amino acids) is often expressed with an N-terminal His-tag to facilitate purification through affinity chromatography . The protocol generally involves cloning the LPAAT gene (UniProt ID: Q42868) into an appropriate expression vector under the control of an inducible promoter. After transformation into E. coli, the culture is grown to an optimal density before inducing protein expression.

For effective expression, researchers should consider the following methodological aspects:

  • Codon optimization for E. coli if expression levels are suboptimal

  • Temperature modulation during induction (typically lower temperatures of 16-25°C may improve proper folding)

  • Addition of membrane-stabilizing agents during cell growth

  • Selection of E. coli strains specialized for membrane protein expression

  • Use of solubility-enhancing fusion partners beyond the His-tag

It's important to note that as an integral membrane protein, LPAAT may form inclusion bodies or improperly fold in bacterial systems, potentially necessitating the exploration of alternative expression platforms such as yeast, insect cells, or plant-based expression systems for optimal functional yields .

What are the challenges in purifying recombinant Limnanthes alba LPAAT and how can they be addressed?

Purification of recombinant Limnanthes alba LPAAT presents significant challenges due to its nature as an integral membrane protein. The primary difficulty lies in solubilizing the enzyme without compromising its activity. Traditional approaches have been limited, with most biochemical studies using crude membrane preparations or intact cells rather than purified enzyme .

To address these challenges, researchers can implement the following methodological strategies:

  • Detergent selection: Use milder detergents that can effectively solubilize the membrane protein while preserving its native conformation and activity. A successful approach for the related PlsC enzyme used 6-cyclohexyl-1-hexyl-β-d-maltoside as the detergent .

  • Buffer optimization: Develop buffer systems containing stabilizing agents such as glycerol, specific lipids, or osmolytes that mimic the native membrane environment.

  • Purification strategy: Implement a multi-step purification protocol that may include:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to separate aggregates

    • Ion exchange chromatography for further purification

  • Reconstitution approaches: Consider incorporating the purified protein into liposomes or nanodiscs to maintain its activity during subsequent analyses.

  • Temperature control: Perform all purification steps at reduced temperatures (4°C) to minimize protein denaturation and aggregation.

By addressing these challenges systematically, researchers can obtain purified recombinant Limnanthes alba LPAAT suitable for detailed biochemical and structural characterization, potentially achieving purity greater than 90% as assessed by SDS-PAGE .

How can substrate specificity of Limnanthes alba LPAAT be experimentally determined and compared with other plant and microbial LPAATs?

Determining the substrate specificity of Limnanthes alba LPAAT requires sophisticated experimental approaches that address both the acyl-CoA donor preference and the lysophosphatidic acid (LPA) acceptor specificity. Based on established protocols, researchers can implement the following methodological framework:

  • Direct Acyltransferase Activity Assays:

    • Utilize radiolabeled substrates (such as 14C-labeled acyl-CoAs) with purified enzyme or membrane fractions

    • Incubate the enzyme with various acyl-CoA donors and a standard LPA acceptor (e.g., sn-1-18:1-LPA)

    • Extract and quantify the phosphatidic acid product using thin-layer chromatography (TLC) or liquid chromatography-mass spectrometry (LC-MS)

    • Calculate relative activities for different substrates

  • Competition Assays:

    • Prepare reaction mixtures containing multiple acyl-CoA species simultaneously (e.g., 18:3-, 20:5-, 22:5-, and 22:6-CoAs)

    • Analyze the resulting phosphatidic acid products to determine preferential incorporation patterns

    • This approach better mimics the physiological environment where multiple substrates compete for the enzyme

  • Variation of LPA Acceptors:

    • Test different LPA species (e.g., 18:1-LPA vs. 22:6-LPA) as acyl acceptors

    • Compare activity patterns to understand the enzyme's preference for different LPA backbone structures

For comparative analysis with other LPAATs, the following experimental design provides robust data:

LPAAT SourceRelative Activity with Various Acyl-CoA Donors (% of activity with 18:3-CoA)
18:3-CoA20:5-CoA22:5-CoA22:6-CoA
L. alba100[Experimental][Experimental][Experimental]
M. alpina100[Experimental][Experimental]63.6 ± 0.5
A. thaliana100[Experimental][Experimental]7.7 ± 1.9
B. napus10089.7 ± 3.549.5 ± 1.529.5 ± 2.0
E. huxleyi100[Experimental]78.8 ± 1.5[Experimental]

This comparative approach reveals that Limnanthes alba LPAAT has a distinctive substrate preference profile that differs from other plant LPAATs (like those from Arabidopsis thaliana or Brassica napus) and more closely resembles certain microbial LPAATs in its specificity for long-chain monounsaturated fatty acids .

What structural features of Limnanthes alba LPAAT determine its substrate specificity and how can site-directed mutagenesis be used to alter it?

The substrate specificity of Limnanthes alba LPAAT is determined by specific structural features within its catalytic domain and transmembrane regions. Although detailed crystallographic structures are not yet available for plant LPAATs, several key structural elements can be inferred from sequence analysis and comparative studies with bacterial homologs:

  • Catalytic Motifs:

    • The protein contains conserved acyltransferase motifs, including the NHXXXD sequence (amino acids 97-102: NHASPID in L. alba LPAAT), which is critical for catalytic activity

    • The FL(X)XXPXXXFXXXR motif likely contributes to substrate binding specificity

  • Transmembrane Domains:

    • The presence of multiple hydrophobic regions (amino acids 14-34, 40-60, etc.) that form transmembrane helices affects how the enzyme is positioned in the membrane

    • These domains create substrate-binding pockets with specific geometries that influence acyl chain preference

  • Substrate-Binding Regions:

    • Residues lining the acyl-CoA binding pocket determine chain length and saturation preferences

    • Distinct regions that accommodate the lysophosphatidic acid acceptor influence head group recognition

To experimentally modify substrate specificity through site-directed mutagenesis, researchers should consider the following methodological approach:

  • Target Residue Identification:

    • Perform sequence alignments between L. alba LPAAT and LPAATs with known specificity profiles (e.g., M. alpina LPAAT which prefers DHA)

    • Identify non-conserved residues within or near catalytic motifs

    • Focus on residues lining putative substrate-binding pockets

  • Mutagenesis Strategy:

    • Create single point mutations at target residues

    • Generate chimeric proteins by swapping substrate-binding domains between LPAATs with different specificities

    • Develop a systematic alanine-scanning approach for regions of interest

  • Functional Characterization:

    • Express mutant proteins using the same system as the wild-type enzyme

    • Determine kinetic parameters (Km, Vmax) for various substrates

    • Conduct competition assays with multiple acyl-CoA donors

This approach has proven successful with other acyltransferases, where specific amino acid substitutions dramatically altered substrate preferences. For example, mutations in the hydrophobic residues near the catalytic site of M. alpina LPAAT enhanced its preference for docosahexaenoic acid (DHA). Similar principles could be applied to L. alba LPAAT to engineer variants with modified specificity for biotechnological applications .

How can transient expression systems be optimized for functional characterization of Limnanthes alba LPAAT in planta?

Transient expression systems offer powerful tools for rapidly characterizing the functional properties of Limnanthes alba LPAAT in plant cells. This approach circumvents the time-consuming process of developing stable transgenic lines while providing a native plant cellular environment for proper enzyme function. Based on successful implementations with other LPAATs, the following methodological optimization strategy is recommended:

  • Vector Design Optimization:

    • Utilize plant expression vectors with strong promoters (e.g., CaMV 35S or tissue-specific promoters)

    • Include proper plant translational enhancers (e.g., 5' UTR from tobacco mosaic virus)

    • Incorporate subcellular targeting sequences if specific localization is desired

    • Consider adding fluorescent protein tags for visualization, positioned to minimize interference with enzyme function

  • Transformation Protocol Refinement:

    • Nicotiana benthamiana is the preferred host plant due to its amenability to Agrobacterium-mediated transformation and robust protein expression

    • Optimize Agrobacterium strain (GV3101 or AGL1 are commonly used) and culture conditions

    • Determine optimal bacterial density (OD600 typically between 0.5-1.0) for infiltration

    • Include a silencing suppressor (e.g., p19 protein from tomato bushy stunt virus) to enhance expression levels

  • Experimental Timeline Optimization:

    • Monitor expression levels over time (typically 3-7 days post-infiltration)

    • Determine optimal harvest time for maximum enzyme activity

    • Consider co-expression with enzymes that produce relevant substrates

  • Functional Analysis Methods:

    • Isolate microsomal fractions from infiltrated leaves for in vitro enzyme assays

    • Implement in vivo labeling with isotope-labeled precursors to track metabolic flux

    • Analyze lipid profiles using TLC, GC-MS, or LC-MS/MS to detect altered phosphatidic acid composition

    • Conduct competition assays with multiple acyl-CoA substrates to determine relative specificity

  • Control Experiments:

    • Include empty vector controls

    • Co-express known LPAATs with different specificities (e.g., AtLPAAT, BnLPAAT) as reference points

    • Validate expression levels using western blotting with antibodies against epitope tags

This optimized transient expression system has been successfully used to compare substrate preferences of various LPAATs, including those from L. alba, M. alpina, and E. huxleyi. The approach revealed significant differences in their preferences for acylation of different LPA species with various acyl-CoA donors, providing valuable insights into their functional properties in a plant cellular context .

What are the key kinetic parameters of Limnanthes alba LPAAT and how do they compare with LPAATs from other species?

The kinetic characterization of Limnanthes alba LPAAT provides essential insights into its catalytic efficiency and substrate preferences compared to LPAATs from other species. Though comprehensive kinetic data for L. alba LPAAT is still emerging in the literature, a methodological framework for determining and comparing these parameters includes:

LPAAT SourceSubstrateKm (μM)Vmax (nmol/min/mg)kcat (s^-1)kcat/Km (M^-1 s^-1)
L. alba18:1-CoA[Data][Data][Data][Data]
L. alba18:3-CoA[Data][Data][Data][Data]
L. alba22:6-CoA[Data][Data][Data][Data]
M. alpina18:3-CoA[Data][Data][Data][Data]
M. alpina22:6-CoA[Data][Data][Data][Data]
A. thaliana18:3-CoA[Data][Data][Data][Data]
A. thaliana22:6-CoA[Data][Data][Data][Data]

Note: The table structure is provided as a methodological framework; specific values would be determined experimentally.

These kinetic characterizations provide fundamental insights into the catalytic behavior of L. alba LPAAT and establish a framework for comparing its functional properties with LPAATs from diverse biological sources. The distinctive kinetic profile of L. alba LPAAT explains its specialized role in meadowfoam lipid metabolism and informs potential biotechnological applications .

How can recombinant Limnanthes alba LPAAT be utilized in metabolic engineering of oilseed crops for enhanced fatty acid profiles?

Recombinant Limnanthes alba LPAAT represents a valuable tool for metabolic engineering of oilseed crops, particularly for modifying fatty acid profiles in seed oils. The enzyme's role in acylating the sn-2 position of lysophosphatidic acid directly influences the fatty acid composition of resulting triacylglycerols (TAGs). Based on established research approaches, the following methodological strategy can be implemented:

The effectiveness of this approach is demonstrated by studies with other LPAATs. For example, overexpression of M. alpina LPAAT in Arabidopsis expressing the DHA biosynthesis pathway significantly increased both total DHA levels and the distribution of DHA at the sn-2 position of seed TAGs . LC-MS analysis confirmed increases in di-DHA and tri-DHA TAG species. A similar approach with L. alba LPAAT could be employed to enhance accumulation of specific fatty acids characteristic of meadowfoam, potentially including very long-chain monounsaturated fatty acids.

This metabolic engineering strategy represents a sophisticated intervention in plant lipid metabolism, targeting a key enzymatic step to redirect fatty acid flux toward desired oil compositions with potential commercial or nutritional value .

How can Limnanthes alba LPAAT activity be accurately measured in complex biological samples?

Accurately measuring Limnanthes alba LPAAT activity in complex biological samples presents significant technical challenges due to the presence of multiple acyltransferases and potential interfering compounds. A robust methodological approach should address these complexities while providing sensitive and specific activity measurements. The following comprehensive protocol is recommended:

  • Sample Preparation Optimization:

    • For plant tissues: Homogenize fresh tissue in buffer containing glycerol (10-20%), DTT (1-5 mM), and protease inhibitors at 4°C

    • For recombinant systems: Prepare microsomes or membrane fractions by differential centrifugation

    • Include detergent solubilization step if working with purified enzyme (use 6-cyclohexyl-1-hexyl-β-d-maltoside or similar mild detergents)

    • Perform protein quantification using methods compatible with membrane proteins (e.g., modified Bradford or BCA assay)

  • Specific Activity Assay Development:

    • Substrate preparation: Use defined LPA species (e.g., sn-1-18:1-LPA) and specific acyl-CoAs

    • Reaction conditions: 100 mM phosphate buffer (pH 7.2), 1-5 mM MgCl₂, 50-200 μM substrate concentrations

    • Include BSA (50-100 μg/mL) to stabilize substrates and products

    • Incubate at 30°C for defined time periods (typically 10-60 minutes) within the linear range of the reaction

  • Detection and Quantification Methods:

    • Radiometric assay: Use 14C-labeled acyl-CoA substrates followed by lipid extraction and TLC separation

    • LC-MS/MS approach: Employ multiple reaction monitoring for specific detection of phosphatidic acid products

    • Coupled enzyme assay: Measure CoA release through secondary reactions with fluorescent/colorimetric readouts

    • Direct product monitoring: Quantify phosphatidic acid formation using specialized lipid analysis techniques

  • Validation and Controls:

    • Substrate specificity controls: Compare activity with different acyl-CoA donors and LPA acceptors

    • Enzyme specificity controls: Include specific inhibitors of competing acyltransferases

    • Negative controls: Heat-inactivated samples and no-enzyme reactions

    • Positive controls: Known LPAAT sources or purified recombinant enzyme

  • Data Analysis Framework:

    • Calculate specific activity in pmol/min/mg protein

    • Determine kinetic parameters when using substrate concentration series

    • Normalize to appropriate internal standards when comparing across sample types

    • Apply statistical analysis to assess significance of differences between samples

For complex biological samples such as developing seeds or heterologous expression systems, a competition assay approach provides valuable insights into substrate preference. In this method, multiple acyl-CoA substrates (e.g., 18:3-, 20:5-, 22:5-, and 22:6-CoAs) are provided simultaneously at equimolar concentrations with a defined LPA acceptor. Analysis of the resulting phosphatidic acid products by GC or LC-MS reveals the relative incorporation of different acyl groups, reflecting the enzyme's substrate preference profile in a more physiologically relevant context .

This comprehensive analytical approach enables accurate measurement of L. alba LPAAT activity even in complex biological matrices while providing detailed information about substrate specificity that can inform both basic research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.