Recombinant Limnocottus bergianus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Definition and Background

Recombinant Limnocottus bergianus Rhodopsin (rho) is a genetically engineered protein derived from the rhodopsin gene of Limnocottus bergianus, a freshwater sculpin fish. Rhodopsin is a light-sensitive G-protein-coupled receptor (GPCR) critical for phototransduction in rod photoreceptors. The recombinant form is produced in vitro using bacterial expression systems (e.g., E. coli) and is used primarily in biochemical and structural studies .

Research Applications

This recombinant protein is utilized in:

  1. Structural Biology

    • Crystallization studies to resolve 3D structures of rhodopsin variants.

    • Comparative analysis of fish vs. mammalian rhodopsin (e.g., Sus scrofa vs. Limnocottus) .

  2. Functional Assays

    • Testing photobleaching kinetics and transducin activation.

    • Studying retinal regeneration in non-mammalian models.

  3. Therapeutic Development

    • Reference material for gene therapy targeting RHO mutations (e.g., allele-specific CRISPR editing) .

Comparative Data with Other Species

SpeciesSourceKey Features
Limnocottus bergianusE. coliFull-length (1–289 aa), glycerol-stabilized
Sus scrofa (Pig)E. coliHis-tagged, full-length (1–348 aa)
Procottus jettelesiE. coliPartial sequences available

Challenges and Limitations

  • Expression Challenges: Fish rhodopsins may require specific folding conditions absent in bacterial systems.

  • Functional Validation: No published data confirm light-activated signaling in Limnocottus rhodopsin.

  • Therapeutic Relevance: Limited to preclinical studies; human rhodopsin variants (e.g., T17M) dominate RP research .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have specific format requirements, kindly indicate them in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
All our proteins are shipped with standard blue ice packs by default. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag preference, please communicate your request, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Limnocottus bergianus
Target Names
rho
Target Protein Sequence
YLVNPAGYAALGAYMFLLILIGSPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYSVLGRLGCILEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALACAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRPEKEVTRMVVIMVIAFLVCCLPNA SVAWWIFCNQGSDFGPIFMTLPSFFAKSAAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Rhodopsin, a photoreceptor essential for image-forming vision in low light conditions, plays a crucial role in vision. While most saltwater fish species utilize retinal as their chromophore, freshwater fish predominantly use 3-dehydroretinal, or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. Subsequent phosphorylation of the receptor facilitates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the basic structure of Limnocottus bergianus rhodopsin?

Rhodopsin is a transmembrane protein that belongs to the G protein-coupled receptor (GPCR) family. While specific structural data for Limnocottus bergianus rhodopsin is limited, rhodopsins generally consist of seven transmembrane helices with intrinsic water molecules that contribute to their dynamic properties. The protein contains a chromophore (11-cis retinal) bound via a protonated Schiff base, which isomerizes to all-trans configuration upon light absorption . This isomerization triggers conformational changes that initiate the visual signaling cascade. For recombinant expression studies, structural characterization can be performed using techniques such as X-ray crystallography, which has been instrumental in understanding rhodopsin's molecular architecture.

How does Limnocottus bergianus rhodopsin compare functionally to other vertebrate rhodopsins?

While specific comparative studies of Limnocottus bergianus rhodopsin are not extensively documented, vertebrate rhodopsins generally share core functional properties. They convert light energy into biochemical signals through a process called phototransduction. Upon light absorption, the chromophore isomerizes, inducing conformational changes in the protein that enable interaction with G proteins (typically transducin in vertebrate visual systems) . Different vertebrate rhodopsins may exhibit variations in spectral sensitivity, activation kinetics, and thermal stability, often reflecting evolutionary adaptations to specific ecological niches. Limnocottus bergianus, as a fish likely adapted to the unique conditions of its habitat, may possess rhodopsin with specialized spectral or kinetic properties compared to mammalian counterparts.

What are the key amino acid residues that determine the spectral properties of rhodopsin?

The spectral tuning of rhodopsins is primarily determined by specific amino acid residues in the retinal binding pocket that interact with the chromophore. While specific data for Limnocottus bergianus rhodopsin is not provided, research on other vertebrate rhodopsins has identified key positions that influence absorption maxima. Position 188 (as in the G188C mutation studied in bovine rhodopsin) has been demonstrated to significantly alter spectral properties, creating photocyclic and photoreversible characteristics . Other critical positions typically include residues at sites 83, 122, 261, and 292 (bovine rhodopsin numbering). To determine the specific tuning sites in Limnocottus bergianus rhodopsin, site-directed mutagenesis studies followed by spectroscopic analysis would be required to map the relationship between sequence variations and absorption characteristics.

What expression systems are most effective for recombinant Limnocottus bergianus rhodopsin production?

Based on established protocols for rhodopsin expression, mammalian cell systems, particularly HEK293T cells, provide an effective platform for recombinant rhodopsin production. This system allows proper folding and post-translational modifications essential for functional rhodopsin . The expression typically involves:

  • Cloning the rhodopsin cDNA into a mammalian expression vector (such as pUSRα or pCAGGS)

  • Transfecting HEK293T cells using methods like calcium-phosphate transfection

  • Incubating cells for approximately 48 hours to allow protein expression

  • Adding 11-cis or all-trans retinal to the cell suspension to reconstitute functional photopigments

Alternatively, prokaryotic systems such as E. coli can be used for higher yield, though additional optimization may be required to ensure proper folding .

What is the recommended purification protocol for recombinant rhodopsin?

For high-purity isolation of recombinant rhodopsin, immunoaffinity chromatography has proven most effective. The standard protocol involves:

  • Collecting transfected cells by centrifugation

  • Suspending cells in buffer (typically 50 mM HEPES, 140 mM NaCl, 3 mM MgCl₂, pH 6.5)

  • Solubilizing cell membranes with 1% dodecyl maltoside (DDM)

  • Purifying the protein using a Rho1D4 (anti-rhodopsin monoclonal antibody) affinity column

  • Washing with buffer containing 0.02% DDM

  • Eluting the purified protein using a synthetic peptide with the epitope sequence

This method typically yields highly pure, functional rhodopsin suitable for spectroscopic and biochemical analyses. For structural studies requiring larger quantities, scaling up this protocol while maintaining protein stability is essential.

How can I determine the concentration and purity of purified recombinant rhodopsin?

The concentration and purity of recombinant rhodopsin can be accurately determined through several complementary methods:

  • UV-visible spectrophotometry: Measure absorbance at the λ₍max₎ (typically between 480-520 nm for vertebrate rhodopsins) and calculate concentration using the molar extinction coefficient

  • Purity assessment: Calculate the ratio of absorbance at λ₍max₎ to absorbance at 280 nm (protein peak); a higher ratio indicates greater purity

  • SDS-PAGE analysis: Confirm the presence of a single band at the expected molecular weight (~40 kDa)

  • Western blot using anti-rhodopsin antibodies: Verify identity and assess potential degradation products

For accurate quantification, hydroxylamine bleaching can be used to determine the difference spectrum, which provides a reliable measure of functional protein concentration .

What methods are available for measuring the absorption spectrum and determining λ₍max₎ of recombinant rhodopsin?

The spectral properties of recombinant rhodopsin can be characterized using several complementary approaches:

  • UV-visible absorption spectroscopy: The most direct method uses a spectrophotometer (such as UV-2450 or equivalent) with temperature-controlled cell holders to maintain samples at specific temperatures (0°C, 20°C, or 37°C)

  • Difference spectroscopy: Measuring the spectrum before and after bleaching with hydroxylamine provides the difference spectrum, which clearly identifies the chromophore absorption

  • Flash photolysis: For photocyclic rhodopsins, time-resolved spectroscopy using equipment like the C10000 system (Hamamatsu Photonics) allows monitoring of spectral changes following light exposure

For accurate λ₍max₎ determination, spectra should be recorded in complete darkness before exposure to measuring light, and measurements should be performed at controlled temperatures to account for temperature-dependent spectral shifts.

How can I engineer red-shifted variants of rhodopsin?

Creating red-shifted variants of rhodopsin can be approached through several strategies:

  • Site-directed mutagenesis: Targeting specific amino acids in the retinal binding pocket, particularly at position 188 (as demonstrated in bovine rhodopsin), can significantly alter spectral properties. The G188C mutation has been shown to create photocyclic properties with altered spectral characteristics

  • Machine learning-based approaches: Recent research has utilized ML-based Bayesian experimental design to efficiently screen for red-shifted rhodopsins. This approach identified 65 candidate rhodopsins from 3,022 ion-pumping rhodopsins, with 32 out of 39 expressed genes showing positive red-shift compared to their base wavelength

  • Rational design based on comparative analysis: By aligning the sequence of Limnocottus bergianus rhodopsin with naturally red-shifted rhodopsins, key residues can be identified and targeted for mutagenesis

For experimental validation, express the mutant rhodopsins in HEK293T cells or E. coli, reconstitute with retinal, and measure the absorption spectra to quantify the red-shift relative to wild-type protein .

What analytical techniques can determine retinal isomer configuration in rhodopsin samples?

Retinal isomer configuration is critical for rhodopsin function and can be analyzed using:

  • High-performance liquid chromatography (HPLC): The gold standard method uses a silica column (such as YMC-Pack SIL, particle size 3 μm, 150 × 6.0 mm) to separate and quantify different retinal isomers (11-cis vs. all-trans)

  • Resonance Raman spectroscopy: Provides vibrational fingerprints characteristic of specific retinal configurations without requiring extraction

  • UV-visible spectroscopy: Different retinal isomers show characteristic absorption differences, particularly after photoisomerization

For HPLC analysis, retinal must be extracted from the protein under dim red light conditions, typically using acidified methanol followed by hexane extraction. The separated isomers can be quantified by comparing peak areas with reference standards .

How can I assess G protein activation by recombinant rhodopsin?

G protein activation can be quantitatively measured through several established assays:

  • GDP/GTPγS exchange assay: This radionucleotide filter-binding assay directly measures the rate of GDP/GTPγS exchange in G proteins. The protocol involves:

    • Mixing purified rhodopsin (10 nM) with G protein (600 nM)

    • Adding [³⁵S]GTPγS and GDP in appropriate buffer

    • Light-activating the sample

    • Measuring bound [³⁵S]GTPγS using a scintillation counter

  • cAMP assay using biosensors: For cell-based assays, the GloSensor cAMP assay provides a real-time readout of G protein signaling by measuring luminescence changes in response to rhodopsin activation. The protocol involves:

    • Co-transfecting HEK293T cells with rhodopsin and GloSensor plasmids

    • Incubating with retinal and GloSensor reagent

    • Measuring luminescence changes upon light stimulation

  • Electrophysiological recordings: For direct measurement of rhodopsin-mediated ion currents in expression systems

These assays allow quantitative comparison between wild-type and mutant rhodopsins to evaluate functional consequences of specific sequence variations.

What methods are available to study the photocycle kinetics of rhodopsin?

The photocycle kinetics of rhodopsin can be studied using several complementary approaches:

  • Time-resolved spectroscopy: Using equipment such as a C10000 system (Hamamatsu Photonics), absorbance changes can be monitored after flash photolysis at millisecond to second timescales. This reveals the formation and decay of photointermediates

  • Low-temperature trapping: Certain photointermediates can be stabilized at specific temperatures, allowing detailed spectroscopic characterization

  • Laser-induced transient absorption spectroscopy: Provides higher time resolution (nanoseconds to microseconds) to capture early photointermediates

For data analysis, absorbance changes at λ₍max₎ are typically plotted against time and fitted with exponential functions to determine time constants for each transition in the photocycle. This approach has been successfully used to characterize photocyclic rhodopsin variants such as the G188C mutant .

How does thermal stability of recombinant rhodopsin impact experimental design?

Thermal stability is a critical parameter that influences numerous aspects of rhodopsin research:

  • Experimental temperature selection: Rhodopsin samples should be maintained at appropriate temperatures during purification and analysis. Stability studies typically monitor absorbance changes at 0°C, 20°C, and 37°C to determine temperature-dependent decay rates

  • Storage conditions: Purified rhodopsin samples generally require storage at -80°C for long-term stability

  • Assay duration planning: The thermal decay rate determines the maximum time window for functional assays at a given temperature

  • Mutations impact: Amino acid substitutions can significantly alter thermal stability, requiring adaptation of experimental conditions

To quantify thermal stability, monitor the decrease in absorbance at λ₍max₎ over time at constant temperature and fit the data to determine the half-life. This information should guide experimental design, particularly for functional assays requiring extended incubation periods.

How can recombinant rhodopsin be used in optogenetic applications?

Recombinant rhodopsin has significant potential in optogenetic applications:

  • Gene therapy for retinal degeneration: Studies have demonstrated that AAV-mediated delivery of wild-type rhodopsin can preserve retinal function in mouse models of autosomal dominant retinitis pigmentosa. In P23H RHO transgenic mice, expression of normal rhodopsin slowed retinal degeneration, increasing ERG a-wave amplitudes by 100% and b-wave amplitudes by 79% at 6 months

  • Designer photoreceptors: Engineering rhodopsin variants with specific spectral or kinetic properties allows precise control of neuronal activity with different wavelengths of light

  • Bistable optogenetic tools: Photocyclic rhodopsin variants (like G188C mutant) that can be switched between active and inactive states with different wavelengths of light provide temporal control of signaling

Implementation requires optimizing expression vectors (typically AAV-based for in vivo applications), promoter selection for cell-type specificity, and careful titration of expression levels, as overexpression of rhodopsin in normal photoreceptors can be detrimental .

What insights can rhodopsin oligomerization studies provide for GPCR research?

Rhodopsin oligomerization represents an important research area with broader implications for GPCR biology:

  • Physiological relevance: Rhodopsin forms oligomers in native membranes, with measured Kd between opsin molecules of approximately 10⁻⁵ M. Understanding the specific arrangement of these complexes remains a priority question in the field

  • Methodological approaches:

    • Resonance energy transfer techniques (FRET/BRET)

    • Chemical cross-linking

    • Atomic force microscopy

    • Native gel electrophoresis

  • Functional consequences: Potential impacts on signaling efficiency, receptor trafficking, and drug responses make oligomerization studies highly relevant for pharmacological research

  • Translation to other GPCRs: As a prototypical GPCR, insights from rhodopsin oligomerization can inform understanding of other members of this receptor superfamily

Future research directions should focus on determining which specific helices are involved in rhodopsin oligomer formation and the thermodynamic parameters governing these interactions.

How can machine learning approaches enhance rhodopsin engineering?

Machine learning (ML) offers powerful tools for rhodopsin engineering:

  • Predictive screening: ML-based Bayesian experimental design has demonstrated success in identifying red-shifted rhodopsin variants. In one study, this approach selected 65 candidates from 3,022 ion-pumping rhodopsins, with 32 out of 39 expressed genes showing successful red-shifting

  • Structure-function relationship modeling: ML algorithms can analyze large datasets of rhodopsin variants to identify non-obvious correlations between sequence features and functional properties

  • Experimental design optimization: ML can guide the selection of the most informative experiments to maximize knowledge gain while minimizing resource expenditure

  • Implementation approach:

    • Gather diverse rhodopsin sequence and functional data

    • Train ML models on this dataset

    • Use trained models to prioritize candidate sequences for experimental testing

    • Validate with experimental characterization

    • Iteratively refine models with new data

This integrated computational-experimental approach significantly improves efficiency compared to traditional directed evolution or rational design methods alone .

What are common challenges in obtaining functional recombinant rhodopsin and their solutions?

Researchers frequently encounter several challenges when working with recombinant rhodopsin:

ChallengePotential CausesSolutions
Low expression levelsSuboptimal codon usage, toxic to host cellsCodon optimization, use of inducible promoters, lower expression temperature
Improper foldingInsufficient chaperones, incorrect membrane insertionExpression in mammalian cells, inclusion of folding enhancers
Poor chromophore incorporationLimited retinal accessibility, incorrect protein foldingOptimize retinal:protein ratio, ensure proper reconstitution conditions
Protein aggregationHydrophobic interactions between misfolded proteinsOptimize detergent type and concentration, use stabilizing additives
Loss of function during purificationDetergent-induced conformational changesScreen detergents, include stabilizing agents (e.g., glycerol)

For recombinant Limnocottus bergianus rhodopsin specifically, optimization of expression conditions based on these parameters will likely be required to achieve high yields of functional protein.

How can I differentiate between functional and non-functional recombinant rhodopsin?

Distinguishing functional from non-functional recombinant rhodopsin requires several complementary approaches:

  • Spectroscopic analysis: Functional rhodopsin exhibits characteristic absorption peaks that change upon light exposure. The bleaching test with hydroxylamine provides a definitive assessment - functional rhodopsin shows a clear shift in absorption spectrum upon hydroxylamine treatment

  • G protein activation assays: Measure the ability to activate G proteins using GDP/GTPγS exchange assays or cAMP biosensor assays in response to light stimulation

  • Thermal stability: Properly folded, functional rhodopsin exhibits characteristic thermal stability that can be monitored by tracking absorbance changes over time at controlled temperatures

  • Retinal isomer analysis: HPLC analysis of extracted retinal can confirm correct chromophore binding and isomerization capabilities

  • Cellular localization: In expression systems, functional rhodopsin typically shows proper membrane localization that can be visualized by immunofluorescence

Non-functional protein may show abnormal spectral properties, inability to activate downstream signaling, poor thermal stability, or incorrect cellular localization.

What strategies can improve the stability of purified recombinant rhodopsin for structural studies?

For structural studies requiring stable, purified rhodopsin:

  • Optimized buffer composition:

    • Include appropriate detergents (typically DDM at 0.02%)

    • Add stabilizing agents (glycerol 10%, cholesterol hemisuccinate)

    • Control pH precisely (typically pH 6.5)

    • Include protease inhibitors to prevent degradation

  • Protein engineering approaches:

    • Thermostabilizing mutations based on computational prediction

    • Fusion with stabilizing proteins or domains

    • Removal of flexible regions that may promote aggregation

  • Handling precautions:

    • Maintain samples under dim red light

    • Store at appropriate temperatures (-80°C for long-term)

    • Minimize freeze-thaw cycles

    • Handle all samples on ice when possible

  • Advanced stabilization:

    • Lipid nanodisc reconstitution to provide native-like membrane environment

    • Antibody fragment complexation to stabilize specific conformations

    • Chemical cross-linking to lock protein in desired conformations

These approaches have proven successful for structural studies of rhodopsin and other GPCRs, enabling techniques such as X-ray crystallography and cryo-electron microscopy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.