Recombinant Limnocottus pallidus Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Limnocottus pallidus Rhodopsin

Recombinant Limnocottus pallidus rhodopsin (rho) is a light-sensitive G protein-coupled receptor (GPCR) engineered for experimental studies. As a member of the Class A (Rhodopsin) GPCR family, it shares structural and functional homology with vertebrate visual pigments but exhibits species-specific adaptations for dim-light vision in its native organism, the pale marbled sculpin (Limnocottus pallidus) . Recombinant production enables detailed biophysical and pharmacological analyses of its phototransduction mechanisms, folding stability, and mutational effects observed in retinal diseases.

Expression Systems

While specific protocols for Limnocottus pallidus rhodopsin are not explicitly documented, analogous recombinant rhodopsins (e.g., pig and human) are typically expressed in E. coli or mammalian systems with N-terminal His tags for purification . The PiggyBac transposon system has been validated for high-yield expression of rhodopsin mutants in HEK293 cells, enabling structural studies via NMR or cryo-EM .

Stability and Folding Defects

Mutations in the N-terminal cap (e.g., T4K, P23H) destabilize opsin during biosynthesis, leading to misfolding and accelerated metarhodopsin II decay—a hallmark of retinitis pigmentosa (RP) . Disulfide bond engineering (e.g., N2C/D282C) restores stability in select mutants by tethering the cap to transmembrane domains .

Phototransduction Dynamics

Limnocottus pallidus rhodopsin exhibits a λmax near 500 nm, similar to other freshwater fish opsins. Mutations in extracellular loops (e.g., G101V, V104F) disrupt photobleaching kinetics and reduce transducin activation by up to 82% compared to wild-type .

Disease Modeling

RP-associated mutations (e.g., P23H) in homologous human rhodopsin are studied using recombinant systems to screen pharmacological chaperones like 9-cis-retinal and non-retinoid compounds (e.g., PLOS Biology 2025 candidates), which stabilize misfolded opsins and improve trafficking .

Genome Editing Strategies

CRISPR/Cas9-based "knockout and replace" therapies (e.g., EDIT-103) target dominant RHO mutations by ablating mutant alleles and reintroducing functional rhodopsin—a strategy potentially adaptable to Limnocottus pallidus models .

Comparative Analysis with Vertebrate Rhodopsins

Table 2: Cross-Species Comparison

FeatureLimnocottus pallidus Human Pig
Length (aa)348348348
Expression HostNot specifiedHEK293, E. coliE. coli
ThermostabilityModerateLow (mutant-dependent)High (with tags)
RP MutationsNot characterized>150 knownP23A, G101V studied

Research Challenges and Opportunities

  • Limitations: No in vivo functional data or crystal structures exist for Limnocottus pallidus rhodopsin, necessitating homology modeling from bovine or human templates .

  • Future Directions: High-throughput mutagenesis and cryo-EM could elucidate its role in low-light adaptation, while RNA therapeutics (e.g., QR-1123) offer translational insights for RP .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. For dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize developing it.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Limnocottus pallidus
Target Names
rho
Target Protein Sequence
YLVNPAGYAALGAYMFLLILIGFPVNFLTLYVTLEHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVGLKPIRNFRFT EDHAIMGLAFSWVMALSCAVPPLAGWLRYIPEGIQGSCGVDYYTRAEGFNNESFVIYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKRPAIYNPMIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as a chromophore, freshwater fish primarily use 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation facilitates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Limnocottus pallidus Rhodopsin and what expression systems are suitable for its production?

Limnocottus pallidus Rhodopsin is a photoreceptive membrane protein from the sculpin fish Limnocottus pallidus, featuring the characteristic heptahelical transmembrane architecture that contains a retinal chromophore common to all rhodopsins . As a member of the animal rhodopsin family, it likely functions as a G-protein coupled receptor involved in light detection and visual signal transduction.

For recombinant expression, several host systems offer distinct advantages:

  • E. coli and yeast systems provide the best yields and shorter turnaround times, making them cost-effective for initial structural studies .

  • Insect cells with baculovirus expression systems offer many of the posttranslational modifications necessary for correct protein folding, potentially improving functional integrity .

  • Mammalian cell expression can provide the most native-like environment, helping retain the protein's activity through appropriate posttranslational modifications and membrane composition .

The choice between these systems should be guided by specific research requirements, balancing between yield, functional integrity, and the presence of native-like modifications.

How does rhodopsin function as a photoreceptor at the molecular level?

Rhodopsin functions through a precisely coordinated photochemical cycle that converts light energy into conformational changes that trigger cellular signaling. The process begins with the absorption of a photon by the 11-cis-retinal chromophore covalently attached to the protein via a Schiff base linkage to a conserved lysine residue (equivalent to K296 in bovine rhodopsin) . This absorption triggers isomerization of 11-cis-retinal to all-trans-retinal, inducing conformational changes that propagate through the protein structure.

These structural changes expose binding sites on the cytoplasmic face of rhodopsin that enable interaction with G-proteins, particularly transducin (G(t)alpha) in photoreceptor cells . The C-terminal regions of G-protein alpha-subunits play crucial roles in this selective activation . Once activated, rhodopsin catalyzes nucleotide exchange on the G-protein, promoting the release of GDP and binding of GTP, thereby initiating the visual signaling cascade.

The active state of rhodopsin is transient, as inactivation mechanisms quickly terminate signaling. In Limulus (horseshoe crab) photoreceptors, this inactivation process occurs rapidly (less than 150 ms) and happens before the peak of the receptor potential . Light adaptation can modulate this inactivation process, with studies showing that light adaptation can accelerate inactivation by about 10-fold in some species .

What are the key differences between animal rhodopsins like Limnocottus pallidus Rhodopsin and microbial rhodopsins?

Animal rhodopsins, including Limnocottus pallidus Rhodopsin, differ fundamentally from microbial rhodopsins in several important aspects:

FeatureAnimal RhodopsinsMicrobial Rhodopsins
Primary functionVisual signal transductionVarious (ion pumps, channels, sensors)
Signaling mechanismG-protein coupled receptor cascadeDirect ion transport or enzyme activity
Retinal isomer11-cis-retinal (dark state)all-trans-retinal (dark state)
Photoisomerization11-cis → all-transall-trans → 13-cis
Schiff baseProtonated, counterion-stabilizedProtonated or deprotonated depending on type
RegenerationRequires enzymatic retinal regeneration pathwayThermal reisomerization within protein
Sequence homologyShare homology with GPCRsNo homology with animal rhodopsins

While both families share the seven transmembrane helix architecture and utilize retinal chromophores, they evolved independently and represent a remarkable case of convergent evolution . Microbial rhodopsins were discovered 95 years after animal rhodopsins, but recent genomic and metagenomic analyses have revealed more than 10,000 microbial rhodopsins compared to about 9,000 animal rhodopsins, with tremendous functional diversity .

What optimizations are necessary for high-yield expression of functional Limnocottus pallidus Rhodopsin?

Achieving high-yield expression of functional Limnocottus pallidus Rhodopsin requires systematic optimization of multiple parameters:

  • Host selection and genetic modifications:

    • E. coli strains like BL21(DE3), C41(DE3), or C43(DE3) contain mutations that improve membrane protein tolerance .

    • Codon optimization for the host organism can significantly improve translation efficiency.

    • Fusion tags (SUMO, MBP, thioredoxin) can enhance solubility and proper folding.

  • Expression conditions:

    • Temperature reduction (16-20°C) during induction slows protein synthesis, allowing proper folding.

    • Inducer concentration optimization (0.1-0.5 mM IPTG for E. coli) prevents aggregate formation.

    • Extended expression times (24-48 hours) at lower temperatures often improve yield of functional protein.

    • Media supplementation with glycerol (0.5-1%) can improve membrane protein expression.

  • Retinal supplementation:

    • Addition of 9-cis-retinal (5-10 μM) during expression enhances proper folding by stabilizing the native conformation .

    • Timing of retinal addition requires optimization (typically at mid-log phase or at induction).

  • Membrane fraction enrichment:

    • Specialized extraction techniques to separate membrane fractions containing properly inserted rhodopsin.

    • Density gradient centrifugation to isolate specific membrane fractions with highest rhodopsin content.

  • Solubilization screening:

    • Systematic testing of different detergents (DDM, LMNG, GDN) at various concentrations.

    • Addition of cholesterol or specific lipids often enhances stability during solubilization.

These optimizations typically require empirical testing for each specific rhodopsin variant, as the determinants of expression efficiency can vary significantly even between closely related proteins.

What analytical methods can confirm the structural integrity of purified Limnocottus pallidus Rhodopsin?

Confirming the structural integrity of purified Limnocottus pallidus Rhodopsin requires a multi-method approach:

  • Spectroscopic analysis:

    • UV-visible absorption spectroscopy: Properly folded rhodopsin with bound retinal typically shows characteristic absorption maximum around 500 nm (exact wavelength depends on species) .

    • Circular dichroism (CD): Provides information about secondary structure content and can detect significant misfolding.

    • Fluorescence spectroscopy: Tryptophan fluorescence patterns reflect tertiary structure integrity.

  • Biochemical assessment:

    • Size-exclusion chromatography (SEC): Monodisperse elution profile indicates properly folded protein rather than aggregates.

    • Limited proteolysis: Properly folded proteins show discrete digestion patterns compared to misfolded variants.

    • Thermal stability assays using differential scanning fluorimetry to determine melting temperature.

  • Functional verification:

    • Light-induced spectral shifts demonstrate photoreactivity.

    • G-protein activation assays confirm signal transduction capability .

    • Transducin binding assays verify proper exposure of interaction surfaces.

  • Structural techniques:

    • Negative-stain electron microscopy to assess homogeneity and gross structural features.

    • Mass spectrometry to confirm intact mass and posttranslational modifications.

    • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility patterns.

  • Ligand binding analysis:

    • Retinal binding and release kinetics using fluorescence or absorbance spectroscopy.

    • Competitive binding assays with rhodopsin ligands.

These complementary approaches provide a comprehensive assessment of both structural and functional integrity, which is essential given the complex folding requirements of membrane proteins like rhodopsin.

What strategies can overcome common challenges in crystallizing Limnocottus pallidus Rhodopsin for structural studies?

Crystallizing membrane proteins like Limnocottus pallidus Rhodopsin presents numerous challenges that can be addressed through specialized strategies:

  • Construct engineering:

    • Truncation of flexible N- and C-termini to reduce conformational heterogeneity.

    • Strategic mutation of surface residues to enhance crystal contacts without perturbing function.

    • Fusion with crystallization chaperones like T4 lysozyme or BRIL that provide rigid surfaces for crystal contacts.

  • Protein stabilization:

    • Addition of 9-cis-retinal or other high-affinity ligands to stabilize a specific conformation .

    • Incorporation of thermostabilizing mutations identified through systematic alanine scanning.

    • Use of antibody fragments (Fab or nanobody) to stabilize flexible regions and provide crystal contacts.

  • Detergent and lipid optimization:

    • Systematic screening of different detergent types, concentrations, and mixtures.

    • Addition of specific lipids that enhance stability (cholesterol, phospholipids).

    • Lipidic cubic phase (LCP) crystallization as an alternative to detergent-based methods.

    • Reconstitution into nanodiscs or amphipols to maintain a more native-like environment.

  • Crystallization condition screening:

    • Specialized sparse matrix screens designed for membrane proteins.

    • Manipulation of temperature, ranging from 4°C to 20°C.

    • Addition of small molecules that enhance crystal packing.

    • Exploration of alternative crystallization methods like vapor diffusion, batch, and LCP.

  • Crystal handling and data collection:

    • Use of controlled dehydration to improve diffraction quality.

    • Microseeding to promote crystal growth from pre-formed nuclei.

    • Merging data from multiple microcrystals using microfocus beamlines.

These approaches have proven successful for other rhodopsins and can be adapted specifically for Limnocottus pallidus Rhodopsin, though extensive screening and optimization are typically required before obtaining diffraction-quality crystals.

How can researchers characterize the photocycle kinetics of Limnocottus pallidus Rhodopsin?

Characterizing the photocycle kinetics of Limnocottus pallidus Rhodopsin requires specialized techniques that can capture transient states with appropriate temporal resolution:

  • Time-resolved absorption spectroscopy:

    • Flash photolysis coupled with UV-visible spectroscopy to track formation and decay of photointermediates.

    • Millisecond-to-second timescale transitions can be measured using stopped-flow devices.

    • Microsecond-to-millisecond timescale requires specialized fast detection systems.

    • Temperature dependence studies can determine activation energies for each transition.

  • Low-temperature trapping:

    • Stabilization of specific photointermediates at low temperatures (77K to 200K).

    • Sequential warming to allow controlled progression through the photocycle.

    • Coupled with spectroscopic measurements to characterize each intermediate.

  • Time-resolved vibrational spectroscopy:

    • FTIR difference spectroscopy to detect specific bond changes during photoactivation.

    • Resonance Raman spectroscopy to track chromophore configuration changes.

    • Can provide atomic-level detail of structural changes during the photocycle.

  • Electrophysiological approaches:

    • Patch-clamp recordings in cells expressing the rhodopsin and appropriate signaling components.

    • Measurement of G-protein-activated current responses following light stimulation.

    • Double-flash paradigms to assess rhodopsin inactivation kinetics, similar to methods used for Limulus rhodopsin .

  • Data analysis and modeling:

    • Global fitting of spectral data to extract rate constants for transitions between photointermediates.

    • Arrhenius analysis to determine activation energies.

    • Numerical simulation of proposed reaction schemes to validate kinetic models.

From these analyses, researchers can construct a complete photocycle model that includes all intermediates and their interconversion rates, providing insights into the molecular mechanism of photoactivation and inactivation.

What methods can determine the G-protein coupling specificity and efficiency of Limnocottus pallidus Rhodopsin?

Understanding G-protein coupling specificity and efficiency requires quantitative approaches that can measure both binding and activation:

  • In vitro G-protein activation assays:

    • GTPγS binding assays measuring the rate of nucleotide exchange upon light activation.

    • Fluorescent GTP analogs can provide real-time kinetic data.

    • Dose-response relationships with varying rhodopsin concentrations determine activation efficiency.

  • Binding affinity measurements:

    • Surface plasmon resonance (SPR) to quantify association and dissociation kinetics between rhodopsin and different G-protein subtypes.

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of the interaction.

    • Fluorescence anisotropy measurements using labeled G-proteins or rhodopsin.

  • Structural approaches to coupling:

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in the interaction.

    • Cross-linking coupled with mass spectrometry to map interaction interfaces.

    • Mutagenesis of the rhodopsin C-terminus, which is critical for G-protein recognition .

  • Chimeric protein studies:

    • Creation of chimeric G-proteins with substituted C-terminal regions to identify critical determinants of coupling specificity.

    • Studies with G(s)alpha containing C-terminal residues from transducin (G(t)alpha) have shown that as few as 11 C-terminal residues can confer the ability to be activated by rhodopsin .

    • Critical residues like Cys(347) and Gly(348) have been identified as essential for rhodopsin activation of G(t) .

  • Cellular signaling assays:

    • FRET/BRET-based sensors to monitor G-protein activation in living cells.

    • Measurement of second messengers (cAMP, Ca²⁺) downstream of different G-protein pathways.

    • Bioluminescence resonance energy transfer (BRET) between tagged rhodopsin and G-proteins.

These approaches collectively provide a comprehensive understanding of both the specificity and efficiency of G-protein coupling, which may have evolved for the specific visual ecology of Limnocottus pallidus.

How can researchers investigate the effects of pH, temperature, and ionic strength on Limnocottus pallidus Rhodopsin stability and function?

Environmental parameters significantly affect rhodopsin stability and function, requiring systematic analysis:

  • pH dependence studies:

    • Spectroscopic monitoring of absorption maxima shifts across pH range (typically pH 4-9).

    • Assessment of thermal stability (Tm) at different pH values using differential scanning fluorimetry.

    • Measurement of photocycle kinetics as a function of pH to identify rate-limiting protonation steps.

    • Analysis of G-protein activation efficiency across pH range.

  • Temperature effects:

    • Arrhenius plots of activation and inactivation rates to determine activation energies.

    • Thermal stability measurements using circular dichroism or fluorescence to determine melting temperatures.

    • Assessment of functional recovery after thermal challenge to distinguish reversible from irreversible denaturation.

    • Low-temperature spectroscopy to trap and characterize photointermediates.

  • Ionic strength effects:

    • Titration with different salt concentrations to assess electrostatic contributions to stability.

    • Effects of specific ions (Na⁺, K⁺, Ca²⁺, Mg²⁺, Cl⁻) on spectral properties and activation.

    • Measurement of conformational flexibility using hydrogen-deuterium exchange at varying ionic strengths.

  • Combined parameter analysis:

    • Creation of stability phase diagrams plotting multiple parameters.

    • Response surface methodology to model interactions between environmental factors.

    • Statistical design of experiments to efficiently explore the multidimensional parameter space.

  • Comparative analysis:

    • Comparison with rhodopsins from related species from different environments.

    • Correlation of stability profiles with natural habitat conditions (depth, temperature, seasonal variations).

ParameterMeasurement TechniquesExpected Effects
pHUV-Vis spectroscopy, DSF, activity assaysAffects Schiff base protonation, structural stability, and photocycle kinetics
TemperatureCD thermal melts, activity vs. temperature, Arrhenius plotsInfluences protein flexibility, retinal isomerization rate, and G-protein coupling
Ionic strengthSpectroscopy at varying salt concentrations, HDX-MSModulates electrostatic interactions, conformational stability, and Schiff base environment

These studies can reveal adaptations specific to the native environment of Limnocottus pallidus and provide insights into the molecular mechanisms of rhodopsin function.

What computational approaches can predict the impact of mutations on Limnocottus pallidus Rhodopsin stability and function?

Computational methods offer powerful tools for predicting mutation effects on rhodopsin stability and function:

  • Homology modeling and structural analysis:

    • Construction of accurate structural models using crystal structures of related rhodopsins as templates .

    • High-resolution crystal structures of bovine rhodopsin (e.g., PDB 3C9L) serve as excellent templates for homology modeling .

    • Analysis of residue conservation, packing, and interactions to identify structurally or functionally critical positions.

  • Energy calculation methods:

    • Rosetta-based ΔΔG calculations using membrane protein-specific energy functions to estimate effects on stability .

    • FoldX or CUPSAT calculations to predict changes in folding free energy upon mutation.

    • Monte Carlo simulations to sample alternative side-chain conformations.

  • Molecular dynamics simulations:

    • All-atom MD simulations in explicit lipid bilayers to assess dynamic effects of mutations.

    • Analysis of hydrogen bond networks, water-mediated interactions, and conformational flexibility.

    • Free energy perturbation calculations to quantify energetic effects.

  • Machine learning approaches:

    • Convolutional neural networks like KDEEP can predict changes in binding free energy for retinal and other ligands .

    • Support vector machines trained on known rhodopsin mutations can predict new mutation effects.

    • Graph-based models capturing long-range interactions within the protein structure.

  • Ligand binding predictions:

    • Docking simulations to predict effects on retinal binding, similar to approaches used for other rhodopsins .

    • Calculation of protein-ligand interface energy changes in the context of rhodopsin variant models .

    • QM/MM methods for detailed electronic structure analysis of the retinal binding pocket.

  • Specialized prediction tools:

    • Membrane protein-specific tools like ΔG predictor algorithm (https://dgpred.cbr.su.se/) can estimate effects on transmembrane domain integration .

    • Prediction of effects on post-translational modifications and trafficking signals.

These computational approaches can guide experimental design by identifying promising mutations for enhancing stability or altering spectral properties, and by providing mechanistic hypotheses for experimentally observed effects.

How do specific amino acid residues contribute to spectral tuning in rhodopsins, and how might this apply to Limnocottus pallidus Rhodopsin?

Spectral tuning in rhodopsins involves specific amino acid residues that modulate the electronic environment of the retinal chromophore:

  • Key tuning sites in vertebrate rhodopsins:

    • Positions 83, 122, 207, 211, 265, and 292 (bovine rhodopsin numbering) have been identified as major spectral tuning sites across vertebrate visual pigments.

    • Substitutions at these positions can shift the absorption maximum (λmax) by 5-30 nm per substitution.

    • The collective effect of multiple substitutions can tune rhodopsins across the entire visible spectrum.

  • Molecular mechanisms of spectral tuning:

    • Electrostatic effects: Charged or polar residues near the retinal Schiff base can stabilize or destabilize the ground or excited state.

    • Hydrogen bonding networks: Direct or water-mediated hydrogen bonds to the retinal or the Schiff base counterion.

    • Steric effects: Bulky residues can distort the retinal geometry, affecting conjugation.

    • Polarizability effects: Aromatic residues can influence the electronic distribution in the chromophore.

  • Environmental adaptations:

    • Deep-sea fish often have blue-shifted rhodopsins (~480 nm) adapted to available blue light.

    • Shallow-water or freshwater species typically have rhodopsins with λmax around 500-525 nm.

    • Spectral tuning likely reflects the light environment in the specific habitat of Limnocottus pallidus.

  • Structure-based prediction methods:

    • QM/MM calculations can predict absorption spectra based on the structural model.

    • Analysis of the electrostatic potential around the chromophore.

    • Hydrogen bond network analysis focusing on the Schiff base and counterion region.

  • Experimental validation approaches:

    • Site-directed mutagenesis of predicted tuning sites.

    • Hybrid quantum mechanics/molecular mechanics calculations.

    • Resonance Raman spectroscopy to analyze chromophore configuration.

Understanding these principles can guide the rational engineering of Limnocottus pallidus Rhodopsin for specific spectral properties, which may be valuable for optogenetic applications or as sensors across different wavelengths.

How does retinal binding affect the stability and folding of rhodopsins, and what methodologies can quantify this effect for Limnocottus pallidus Rhodopsin?

Retinal binding significantly impacts rhodopsin stability and folding through multiple mechanisms:

  • Thermodynamic coupling between binding and folding:

    • Retinal binding stabilizes the native conformation by linking multiple transmembrane helices.

    • This can be conceptualized as a thermodynamic coupling between binding and folding equilibria .

    • Studies of pathogenic rhodopsin variants demonstrate that 9-cis-retinal can enhance plasma membrane expression by stabilizing the protein .

  • Experimental approaches to quantify stabilization:

    • Plasma membrane expression (PME) measurements in the presence and absence of retinal using flow cytometry or fluorescence microscopy .

    • Thermal stability assays comparing the melting temperature (Tm) with and without retinal.

    • Proteolytic susceptibility assays showing increased resistance to proteolysis when retinal is bound.

    • Detergent stability assays measuring resistance to detergent-induced denaturation.

  • Variant-specific responses to retinal:

    • Different mutations show varying magnitudes of response to retinal addition .

    • Some variants (like S131P) show increased expression with retinal despite failing to regenerate native pigment, suggesting stabilization during early folding events .

    • The response to retinal is generally constrained by protein stability, with severely destabilized variants showing limited improvement .

  • Quantitative analysis framework:

    • Calculation of apparent dissociation constants (Kd) for retinal binding to wild-type and mutant rhodopsins .

    • Determination of the ratio of mutant to wild-type Kd values provides a measure of how mutations affect retinal binding .

    • Computational prediction of changes in binding energetics can identify mutations that directly disrupt binding versus those that primarily affect folding .

  • Functional implications:

    • Some intermediate class II variants (like ΔN73 and R135G) that recover expression in the presence of retinal also regain functional activity .

    • This suggests potential therapeutic approaches targeting retinal or developing molecular chaperones for certain rhodopsin variants .

These methodologies provide insights into the fundamental biophysical principles governing rhodopsin folding and stability, with implications for understanding evolutionary adaptations and disease mechanisms, as well as for developing strategies to enhance recombinant expression.

How can Limnocottus pallidus Rhodopsin be utilized in optogenetic applications?

Limnocottus pallidus Rhodopsin offers potential advantages for optogenetic applications based on its specific properties:

  • GPCR-based optogenetic tool development:

    • As an animal rhodopsin, it functions as a G-protein coupled receptor, enabling modulation of G-protein signaling pathways .

    • This provides complementary capabilities to ion channel-based tools like channelrhodopsins.

    • Can be used to trigger second messenger cascades like cAMP, IP3, or calcium signaling.

  • Engineering considerations:

    • Fusion with fluorescent proteins for visualization and quantification of expression.

    • Targeting sequences for specific subcellular localization.

    • Modification of C-terminal regions to alter G-protein coupling specificity .

    • Chimeric constructs combining regions from different rhodopsins to optimize performance.

  • Potential advantages over existing tools:

    • If adapted to cold environments, may function efficiently at experimental temperatures.

    • May have spectral properties complementary to existing optogenetic tools, enabling multiplexed control.

    • As a vertebrate protein, may fold and traffic more efficiently in mammalian neurons than microbial rhodopsins.

  • Application scenarios:

    • Investigation of G-protein signaling in neuronal function and plasticity.

    • Optical control of signaling in non-neuronal cells like glia, immune cells, or endocrine cells.

    • In vivo modulation of GPCR pathways in animal models to study behavior or physiology.

  • Technical considerations for implementation:

    • Requires addition of exogenous retinal for function in many experimental systems.

    • Co-expression with appropriate G-proteins may be necessary for full functionality.

    • Light delivery parameters need optimization for activation without causing photodamage.

    • Expression levels need careful control to prevent constitutive activity or trafficking issues.

The successful application of Limnocottus pallidus Rhodopsin in optogenetics would require thorough characterization of its photochemical, kinetic, and signaling properties, followed by optimization for specific experimental contexts .

How do the inactivation kinetics of animal rhodopsins like Limnocottus pallidus Rhodopsin compare to other types of photoreceptors?

Inactivation kinetics vary significantly across photoreceptor types, reflecting their diverse functional roles:

  • Animal rhodopsin inactivation mechanisms:

    • Phosphorylation by G-protein-coupled receptor kinases (GRKs).

    • Arrestin binding to phosphorylated rhodopsin blocks further G-protein activation.

    • In Limulus (horseshoe crab) photoreceptors, inactivation occurs rapidly (less than 150 ms) .

    • Light adaptation can accelerate inactivation by about 10-fold, providing an important regulatory mechanism .

  • Comparative inactivation kinetics:

Photoreceptor TypeInactivation MechanismTypical TimescaleRegulation
Animal rhodopsinsPhosphorylation + arrestin150 ms - secondsModulated by light adaptation
Cone opsinsPhosphorylation + arrestin10-100 msFaster than rhodopsin, enabling higher temporal resolution
Microbial rhodopsinsThermal relaxationMilliseconds - secondsVaries widely across types
Plant phototropinsPhotocycle completionSeconds - minutesTemperature-dependent
CryptochromesRedox reactionsMinutes - hoursOften coupled to protein degradation
  • Functional significance of inactivation kinetics:

    • Determines temporal resolution of visual perception.

    • Affects signal-to-noise ratio in dim light conditions.

    • Influences adaptation to changing light conditions.

    • Shapes the frequency response characteristics of photoreceptors.

  • Methodologies for comparative analysis:

    • Electrophysiological recordings using double-flash paradigms .

    • Time-resolved spectroscopy to track photocycle completion.

    • G-protein activation assays with varying light pulse durations.

    • Computational modeling to extract rate constants from experimental data.

  • Environmental adaptations:

    • Species from different light environments often show corresponding adaptations in rhodopsin inactivation kinetics.

    • Fast-moving predatory species typically have faster rhodopsin inactivation for improved temporal resolution.

Understanding these comparative kinetics provides insights into the evolutionary adaptations of different photoreceptor systems and guides the selection or engineering of appropriate tools for specific optogenetic applications.

What approaches can determine if Limnocottus pallidus Rhodopsin has unique properties compared to other fish rhodopsins?

Determining the unique properties of Limnocottus pallidus Rhodopsin requires systematic comparative analysis:

  • Comprehensive characterization approaches:

    • Spectroscopic profiling to determine absorption maximum, extinction coefficient, and photochromic properties.

    • Photocycle kinetics analysis using time-resolved spectroscopy.

    • G-protein coupling specificity and efficiency measurements .

    • Thermal and pH stability profiling under standardized conditions.

  • Comparative genomic analysis:

    • Phylogenetic comparison with rhodopsins from related fish species.

    • Identification of positively selected residues specific to Limnocottus pallidus.

    • Correlation of sequence differences with habitat and ecological niche.

    • Ancestral sequence reconstruction to identify derived features.

  • Structure-function relationship investigations:

    • Homology modeling to identify structural features unique to Limnocottus pallidus Rhodopsin .

    • Identification of unusual residues in functional regions (retinal binding pocket, G-protein interface).

    • Mutagenesis studies converting unique residues to consensus sequences and vice versa.

  • Ecological context analysis:

    • Characterization of the light environment in the natural habitat of Limnocottus pallidus.

    • Correlation of rhodopsin properties with ecological and behavioral characteristics.

    • Comparative analysis with rhodopsins from species occupying similar niches.

  • Expression and biophysical properties:

    • Comparative analysis of expression efficiency in different systems .

    • Assessment of stability in different detergents and reconstitution systems.

    • Ligand binding studies with retinal analogs and potential modulatory compounds.

  • Functional adaptations:

    • Temperature dependence studies reflecting adaptation to specific thermal environments.

    • Light sensitivity and amplification characteristics in reconstituted systems.

    • Inactivation mechanisms and kinetics compared to other species .

This multi-faceted comparative approach can reveal adaptations specific to Limnocottus pallidus that may reflect its evolutionary history and ecological specialization, potentially identifying properties that could be valuable for biotechnological applications or understanding visual ecology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.