Recombinant Lipid A biosynthesis (KDO)2- (lauroyl)-lipid IVA acyltransferase 2

Shipped with Ice Packs
In Stock

Description

Raetz Pathway and Lipid A Biosynthesis

Lipid A biosynthesis occurs through a series of enzymatic steps known as the Raetz pathway . This pathway involves nine sequential steps, starting in the cytoplasm and concluding on the inner surface of the inner membrane .

Key Steps in the Raetz Pathway:

  1. Initiation: The pathway begins with UDP-N-acetylglucosamine (UDP-GlcNAc) and β-hydroxymyristoyl-ACP as substrates .

  2. LpxA Activity: The first committed step is catalyzed by LpxA, which links an acyl chain to the 3-OH group of UDP-GlcNAc .

  3. Lipid IVA Formation: LpxK phosphorylates lipid A disaccharide to produce lipid IVA . Lipid IVA is the minimal LPS structure able to sustain E. coli viability and serves as the acceptor for the Kdo moiety .

  4. Kdo Addition: KdtA (also called WaaA) then transfers two Kdo residues to lipid IVA to produce KDO2-lipid IVA .

  5. Acylation by LpxL and LpxM: The final steps in the Raetz pathway involve the secondary acylation of the R-3-hydroxyacyl chains of KDO2-lipid IVA, which are catalyzed by LpxL and LpxM enzymes .

LpxM: A Key Acyltransferase

LpxM is an acyltransferase that adds a secondary acyl chain to the lipid A molecule . It belongs to the lysophospholipid acyltransferase (LPLAT) superfamily and the lipid A biosynthesis lauryl/myristyl acyltransferases (LABLATs) group .

Regulation of Lipid A Biosynthesis

Lipid A synthesis is regulated through controlled degradation of LpxC and WaaA, both performed by FtsH, an integral membrane AAA-type metalloprotease .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet your needs.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for prioritized development.
Synonyms
lpxM2; msbB; msbB2; CP0238; Lipid A biosynthesis myristoyltransferase 2; Kdo(2-lauroyl-lipid IV(A myristoyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Shigella flexneri
Target Names
lpxM2
Target Protein Sequence
MKKYKSEFIPEFKKNYLSPVYWFTWFVLGMIAGISMFPPSFRDPVLAKIGRWVGRLSRKA RRRATINLSLCFPEKSDTEREIIVDNMFATALQSIVMMAELAIRGPEKFQKRVFWKGLEI LEEIRHNNRNVIFLVPHGWSVDIPAMLLAAQGEKMAAMFHQQRNPVIDYVWNSVRRKFGG RLHSREDGIKPFIQSVRQGYWGYYLPDQDHGPEYSEFADFFATYKATLPIIGRLMNISQA MIIPLFPVYDEKKHFLTIEVRPPMDACIASADNKMIARQMNKTVEILVGSHPEQYIWVLK LLKTRKSNEADPYP
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of myristate from myristoyl-acyl carrier protein (ACP) to Kdo(2)-(lauroyl)-lipid IV(A), producing Kdo(2)-lipid A. It likely also catalyzes the transfer of myristate to Kdo(2)-(palmitoleoyl)-lipid IV(A) to form the cold-adapted Kdo(2)-lipid A.
Database Links

KEGG: sfl:CP0238

Protein Families
LpxL/LpxM/LpxP family, LpxM subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Raetz pathway and how does it contribute to Lipid A biosynthesis?

The Raetz pathway refers to the conserved nine-step enzymatic process that synthesizes Kdo2-lipid A, a critical component of the outer membrane of Gram-negative bacteria. The pathway begins in the cytoplasm and concludes on the inner surface of the inner membrane . The process initiates with UDP-N-acetyl glucosamine as the starting material and involves sequential acylation, deacetylation, and phosphorylation reactions.

Key enzymes in the pathway include:

  • LpxA: Catalyzes the first step, adding an acyl chain to UDP-GlcNAc

  • LpxC: Performs deacetylation of the substrate

  • LpxD: Adds a second acyl chain

  • LpxB: Catalyzes the condensation of two acylated molecules

  • LpxK: Phosphorylates the 4′-position to form lipid IVA

  • KdtA (WaaA): Adds Kdo residues to lipid IVA

  • LpxL and LpxM: Catalyze late acylation steps

The pathway is particularly significant as it produces the minimal LPS substructure required for bacterial growth in most Gram-negative bacteria .

What is the structural and functional significance of lipid IVA in the Lipid A biosynthesis pathway?

Lipid IVA is a crucial intermediate in the Lipid A biosynthesis pathway that represents a tetra-acylated precursor of the mature hexa-acylated Lipid A. It possesses the following characteristics:

  • It has been identified as the minimal LPS structure able to sustain E. coli viability

  • It serves as the acceptor for Kdo moieties, which are added by the transferase KdtA

  • Its molecular recognition varies between species, displaying different biological activities:

    • Acts as an antagonist for human TLR4 signaling

    • Functions as an agonist for mouse and horse TLR4-MD-2

The differing biological activities of lipid IVA across species stem from structural interactions with TLR4-MD-2 complexes. In humans, lipid IVA binds to MD-2 but fails to induce TLR4 dimerization necessary for signaling. In contrast, in mice, lipid IVA induces a conformational change in the receptor complex that promotes dimerization and signal transduction .

How does the LpxM enzyme function in the late acylation stages of Lipid A biosynthesis?

LpxM (also known as MsbB) is a late acyltransferase that catalyzes the addition of the sixth acyl chain to create hexa-acylated Kdo2-lipid A. Specifically:

  • It transfers a myristoyl group to the free OH group of the 3′-O-linked (R)-3-hydroxymyristate residue within penta-acylated intermediates

  • It functions after LpxL, which adds the fifth acyl chain (typically laurate) to the 2′-N-linked (R)-3-hydroxymyristate

  • In E. coli, the substrate preferences of the late acyltransferases establish their ordered action; LpxL acts before LpxM

What expression systems are most effective for producing active recombinant LpxM protein?

Based on the search results and established literature, the following strategies are recommended for producing active recombinant LpxM:

Expression Host:

  • E. coli is the preferred expression system, as demonstrated in several studies

  • BL21(DE3) strain is commonly used for expression of membrane proteins like LpxM

Protein Design:

  • N-terminal His-tag fusion is effective for purification while maintaining activity

  • Full-length expression (rather than truncated versions) is critical for maintaining enzymatic function

Expression Conditions:

  • Induction with IPTG at lower temperatures (16-25°C) improves solubility

  • Addition of membrane-stabilizing agents like glycerol (6%) in the buffer improves protein stability

Storage:

  • The recombinant protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • For long-term storage, addition of glycerol (5-50% final concentration) is recommended

  • Aliquoting is necessary to avoid repeated freeze-thaw cycles

What assays can be employed to measure the enzymatic activity of LpxM?

Several complementary approaches can be used to assess LpxM acyltransferase activity:

Acyl-ACP Release Assay:

  • Measures the release of holo-ACP from acyl-ACP donors

  • Can be monitored using conformationally-sensitive native PAGE or HPLC

  • Allows detection of both transferase and potential thioesterase activities

Mass Spectrometry Analysis:

  • LC-ESI/MS and MALDI-TOF MS are effective for detecting lipid A species

  • Can analyze the conversion of penta-acylated to hexa-acylated lipid A directly

  • Provides accurate molecular weight determination of reaction products

Thin Layer Chromatography:

  • Can be used to separate and visualize lipid A species

  • Particularly useful when combined with radiolabeled substrates

Heterologous Complementation:

  • E. coli strains with mutations in lpxM (e.g., MLK1067) can serve as reporter systems

  • Successfully expressed and functional LpxM restores the production of hexa-acylated lipid A

How can the substrate specificity of LpxM be determined experimentally?

Determining the substrate specificity of LpxM requires systematic analysis of both acyl chain donors and acceptors:

Acyl Chain Donor Specificity:

  • Test various acyl-ACPs with different chain lengths (C12, C14, C16, etc.)

  • Measure relative activity using the acyl-ACP release assay described above

  • Analyze products by mass spectrometry to confirm which acyl chains are transferred

Acyl Chain Acceptor Specificity:

  • Perform enzyme kinetics with varying concentrations of lipid IVA or other lipid A intermediates

  • Determine Km and Vmax values for different substrates

  • For AbLpxM, the apparent Km for lipid IVA was determined to be 1.7 ± 0.6 μM

Structure-Function Analysis:

  • Site-directed mutagenesis of conserved residues to identify those involved in substrate recognition

  • Crystal structure analysis when available to identify substrate binding sites

  • Homology modeling based on related acyltransferases can provide insights

An interesting observation is that some LpxM homologs (like AbLpxM) can utilize lipid IVA as a substrate even without Kdo moieties, while others strictly require Kdo-modified intermediates, indicating species-specific variation in substrate recognition .

How do species-specific variations in LpxM homologs affect Lipid A structure and immunological properties?

Species-specific variations in LpxM homologs significantly impact Lipid A structure and immunological properties:

Structural Variations:

  • Different bacterial species contain LpxM homologs with varying substrate preferences

  • For example, Helicobacter pylori possesses LpxJ that functions similarly to LpxM but differs in sequence homology

  • Some LpxM homologs transfer different acyl chains (laurate vs. myristate) depending on the species

Order of Acylation:

  • In E. coli, Kdo addition must precede LpxL and LpxM acylation

  • In contrast, H. pylori LpxJ can perform 3'-secondary acylation regardless of Kdo presence and can act before LpxL

  • This creates multiple potential routes at the end of the lipid A biosynthesis pathway

Immunological Consequences:
The structural modifications lead to significant immunological differences:

  • Hexa-acylated lipid A is a potent agonist for both mouse and human TLR4

  • Tetra-acylated precursors (lipid IVA) show species-specific responses:

    • Antagonist activity for human TLR4-MD-2

    • Agonist activity for mouse and horse TLR4-MD-2

These species-specific differences can be explained by structural variations in TLR4-MD-2 complexes:

  • In humans, lipid IVA fails to induce TLR4 dimerization

  • In mice, a negatively-charged glutamate residue (E122) at the mouth of the MD-2 binding pocket repulses the phosphate group on lipid IVA, pushing its backbone upward and enabling dimerization

What is the relationship between LpxM function and bacterial antibiotic resistance mechanisms?

The relationship between LpxM function and antibiotic resistance is multifaceted:

Outer Membrane Permeability:

  • LpxM produces the hexa-acylated lipid A that significantly contributes to the outer membrane barrier function

  • Complete lipid A is critical for the structural integrity of the bacterial outer membrane, which serves as the first line of defense against many antibiotics

Resistance to Antimicrobial Peptides:

  • Modifications to lipid A, including those mediated by LpxM, can alter susceptibility to antimicrobial peptides

  • Mutants with altered lipid A acylation patterns often show increased sensitivity to cationic antimicrobial peptides

LpxC Inhibition Strategy:

  • While not directly targeting LpxM, inhibitors of LpxC (another enzyme in the Raetz pathway) represent potent Gram-negative-selective antibiotics

  • Understanding the entire pathway, including LpxM function, is crucial for developing new antimicrobial strategies

Potential for Combined Therapy:

  • Inhibitors targeting LpxM could potentially be used to:

    • Increase the permeability of the outer membrane

    • Enhance the efficacy of existing antibiotics that have difficulty penetrating the outer membrane

    • Attenuate the inflammatory response during infection

Research has shown that targeting lipid A biosynthesis can be a viable strategy for developing new antibiotics against Gram-negative pathogens, as most of these enzymes are essential for bacterial viability .

How does the study of LpxM contribute to understanding evolutionary relationships among bacterial lipid biosynthesis pathways?

The study of LpxM and related enzymes provides significant insights into evolutionary relationships among bacterial lipid biosynthesis pathways:

Conservation of Lipid A Biosynthesis:

  • The Raetz pathway is highly conserved among Gram-negative bacteria, indicating its ancient origin

  • Most Gram-negative bacteria encode single-copy homologues of the nine E. coli enzymes that assemble Kdo2-lipid A

  • The conservation suggests strong selective pressure to maintain this pathway

Divergent Evolution of Late Acyltransferases:

  • While the early steps of lipid A biosynthesis are highly conserved, late acyltransferases like LpxM show greater diversity

  • LpxJ represents a family of lipid A late acyltransferases found in organisms that lack an E. coli LpxM homolog

  • This divergence suggests adaptation to different ecological niches or host immune systems

Relationship to Eukaryotic Lipid Biosynthesis:

  • Interestingly, plants like Arabidopsis thaliana contain nuclear genes encoding orthologs of key enzymes of bacterial lipid A biosynthesis, including LpxA, LpxC, LpxD, LpxB, LpxK and KdtA

  • Plant lipid A biosynthetic genes may have been acquired from Gram-negative bacteria during the endosymbiosis of mitochondria

  • Lipid A-like molecules in plants may serve structural roles in mitochondrial or chloroplast outer membranes

The presence of lipid A biosynthesis genes in plants but not in animals, fungi, or archaea provides a window into evolutionary events:

Taxonomic GroupLipid A Biosynthesis Genes
Gram-negative bacteriaFull complement (9 enzymes)
PlantsPartial complement (6 enzymes)
Gram-positive bacteriaAbsent
ArchaeaAbsent
FungiAbsent
AnimalsAbsent

This distribution pattern supports the endosymbiotic theory and the transfer of genes from bacterial endosymbionts to the nuclear genome of the eukaryotic host .

What are the most common challenges encountered when working with lipid IVA and how can they be addressed?

Working with lipid IVA presents several technical challenges that researchers should anticipate:

Solubility Issues:

  • Lipid IVA has limited solubility in aqueous solutions due to its amphipathic nature

  • Solution: Use detergents like Triton X-100 (0.1-0.25%) or DMSO (up to 10%) as solubilizing agents

  • Alternative: Prepare stock solutions in 1:1 chloroform:methanol and dry under nitrogen before resuspension in assay buffer

Stability Concerns:

  • Lipid IVA can degrade during storage, particularly through hydrolysis of phosphate groups

  • Solution: Store lyophilized lipid IVA at -80°C; for solutions, store in glass vials at -20°C with minimal freeze-thaw cycles

  • Add antioxidants like BHT for long-term storage to prevent lipid oxidation

Quantification Difficulties:

  • Accurate quantification of lipid IVA can be challenging due to its structure

  • Solution: Use multiple quantification methods in parallel, such as:

    • Phosphate assay to measure phosphate content

    • Mass spectrometry for molecular identification and relative quantification

    • TLC with appropriate standards for comparison

Endotoxin Contamination:

  • Commercial preparations of lipid IVA may contain trace amounts of contaminating endotoxin

  • Solution: Use endotoxin testing (LAL assay) to validate purity, especially for immunological studies

  • Consider additional purification steps if necessary

Mass Spectrometry Analysis:

  • Lipid IVA can be challenging to ionize efficiently in mass spectrometry

  • Solution: Use negative ion mode with ammonium or triethylamine as adducts to enhance ionization

  • For MS/MS analysis, optimize collision energy settings specifically for lipid IVA

How can researchers distinguish between the enzymatic activities of different late acyltransferases (LpxL, LpxM, LpxJ) in experimental systems?

Distinguishing between the activities of different late acyltransferases requires careful experimental design:

Substrate Specificity Analysis:

  • LpxL typically adds an acyl chain to the 2'-position, while LpxM adds to the 3'-position

  • LpxJ in some bacteria can acylate the 3'-position but shows different substrate requirements than LpxM

  • Use mass spectrometry or structural analysis to determine which position has been acylated

Kdo-Dependence Testing:

  • LpxL and LpxM in E. coli require Kdo addition before they can act

  • Some homologs like LpxJ from H. pylori can act regardless of Kdo presence

  • Compare activity on lipid IVA with and without Kdo to distinguish these enzymes

Order of Action:

  • In E. coli, LpxL must act before LpxM

  • For enzymes with flexible ordering, test activity on different intermediates (e.g., tetra-acylated vs. penta-acylated substrates)

  • Time-course experiments can help determine the preferred order of action

Knockout Complementation:

  • Use specific knockout strains (e.g., lpxL or lpxM mutants)

  • Introduce genes encoding different acyltransferases and analyze the resulting lipid A structures

  • This approach has been successful in distinguishing LpxJ activity from LpxM

Acyl Chain Preference:

  • Different acyltransferases show preferences for specific acyl-ACP donors:

    • LpxL typically uses lauroyl-ACP

    • LpxM typically uses myristoyl-ACP

    • Analyze the acyl chain composition of the products to help identify which enzyme was active

The combined use of these approaches provides a comprehensive picture of the specific activities of each late acyltransferase.

What considerations should be taken into account when designing heterologous expression systems for functional studies of LpxM from different bacterial species?

When designing heterologous expression systems for LpxM from different bacterial species, researchers should consider:

Codon Optimization:

  • Adapt the coding sequence to the codon usage of the expression host

  • This is particularly important for LpxM from bacteria with significantly different GC content than the expression host

  • Codon optimization can improve expression levels by 2-10 fold depending on the source organism

Membrane Association:

  • LpxM is a membrane-associated enzyme with hydrophobic domains

  • Include membrane targeting sequences appropriate for the expression host

  • Consider fusion partners that aid in membrane insertion (e.g., MBP for periplasmic targeting)

Expression Temperature:

  • Lower temperatures (16-20°C) often improve the folding of membrane proteins

  • Extended expression times at lower temperatures may be necessary to obtain sufficient protein

Host Selection:

  • E. coli C41(DE3) or C43(DE3) strains are recommended for membrane proteins

  • For functional studies, consider using an lpxM-deficient strain like MLK1067 to avoid background activity

  • The host lipid composition may affect enzyme folding and activity

Induction Strategy:

  • Use lower inducer concentrations (0.1-0.5 mM IPTG) to prevent inclusion body formation

  • Consider autoinduction media for gentler, more gradual protein expression

Fusion Tags:

  • N-terminal His-tags have been successfully used for purification

  • Position the tag to avoid interference with the catalytic domain

  • Include a protease cleavage site if tag removal is desired for activity studies

Species-Specific Considerations:

  • Different LpxM homologs may have different pH optima and salt requirements

  • Optimize buffer conditions for each species-specific enzyme

  • Account for potential cofactor requirements that may vary between species

These considerations ensure optimal expression and functional activity when studying LpxM from diverse bacterial sources.

How might advanced structural biology techniques enhance our understanding of LpxM function and facilitate inhibitor development?

Advanced structural biology techniques offer promising approaches to deepen our understanding of LpxM:

Cryo-Electron Microscopy:

  • Cryo-EM is increasingly powerful for membrane protein structure determination

  • Could reveal LpxM in different conformational states during catalysis

  • Might capture the enzyme-substrate complex without the need for crystallization

Molecular Dynamics Simulations:

  • Can model the interaction of LpxM with the membrane environment

  • Allows investigation of substrate binding and product release pathways

  • Helps identify potential allosteric sites that could be targeted by inhibitors

Hydrogen-Deuterium Exchange Mass Spectrometry:

  • Can map regions of conformational change upon substrate binding

  • Identifies protected areas that may represent binding interfaces

  • Works with relatively small amounts of protein and doesn't require crystals

Structure-Guided Mutagenesis:

  • Based on existing structural data, targeted mutations can validate the roles of specific residues

  • Systematic analysis of the "hydrocarbon ruler" mechanism that determines acyl chain specificity

  • Can help design enzymes with altered substrate preferences for biotechnological applications

Time-Resolved Structural Studies:

  • X-ray free-electron laser (XFEL) techniques could capture short-lived intermediates

  • May reveal the precise catalytic mechanism and transition states

  • Could guide the design of transition-state mimetics as potent inhibitors

These approaches could lead to significant advances in both fundamental understanding and applied aspects of LpxM research.

What are the implications of understanding plant lipid A biosynthesis pathways for evolutionary biology and potential biotechnological applications?

The discovery of lipid A biosynthesis pathways in plants has profound implications:

Evolutionary Insights:

  • Plants contain nuclear genes encoding orthologs of six of the nine enzymes in the bacterial Raetz pathway

  • This suggests endosymbiotic gene transfer from ancestral bacterial endosymbionts

  • Comparing plant and bacterial enzymes may reveal evolutionary adaptations

Functional Role in Plants:

  • Plant lipid A precursors have been detected in mitochondria and chloroplasts

  • They may serve structural roles in organellar membranes

  • Alternatively, they might function in signaling or defense mechanisms

Potential Biotechnological Applications:

  • Engineering of plant lipid A biosynthesis could modulate plant immune responses

  • Lipid A-based adjuvants derived from plants could offer novel vaccine formulations

  • Modification of these pathways might enhance plant resistance to bacterial pathogens

Comparative Biochemistry:

  • Plant LpxM-like enzymes may have evolved different substrate specificities

  • Understanding these differences could provide insights into acyltransferase evolution

  • The knowledge could be applied to engineer enzymes with novel activities

The presence of the pathway in plants but its absence in animals offers unique opportunities:

  • Targeted inhibitors of plant-specific lipid A biosynthesis could lead to novel herbicides

  • Plant systems could be used to produce modified lipid A structures with reduced toxicity for therapeutic applications

  • Comparative analysis could reveal how plants adapted bacterial pathways for eukaryotic functions

How can computational approaches be leveraged to predict the effects of LpxM mutations on lipid A structure and immunogenicity?

Computational approaches offer powerful tools for predicting the effects of LpxM mutations:

Homology Modeling and Molecular Docking:

  • Generate structural models of LpxM variants based on known structures

  • Dock substrate molecules to predict binding affinity changes

  • Identify critical interactions that may be disrupted by mutations

Molecular Dynamics Simulations:

  • Simulate the behavior of mutant enzymes in membrane environments

  • Predict changes in protein flexibility and substrate accessibility

  • Model the impact on catalytic mechanism and efficiency

Quantitative Structure-Activity Relationship (QSAR):

  • Correlate structural features of LpxM variants with experimental activity data

  • Develop predictive models for enzyme activity based on sequence variations

  • Extrapolate to unstudied mutations to prioritize experimental work

Machine Learning Approaches:

  • Train algorithms on existing data linking LpxM sequence to lipid A structure

  • Incorporate data from multiple species to improve predictive power

  • Identify non-obvious patterns in sequence-structure-function relationships

Immunoinformatics:

  • Predict how lipid A structural changes affect TLR4-MD-2 binding

  • Model species-specific immune responses to variant lipid A structures

  • Simulate the impact of LpxM mutations on host-pathogen interactions

Integration with Experimental Data:

  • Combine computational predictions with targeted mutagenesis experiments

  • Use high-throughput experimental data to refine computational models

  • Develop iterative workflows that alternate between prediction and validation

These approaches could significantly accelerate research by reducing the need for exhaustive experimental testing of all possible mutations, focusing laboratory efforts on the most promising variants.

What is the potential for developing LpxM-targeted approaches for vaccine adjuvant development and immunomodulation?

LpxM-targeted approaches offer intriguing possibilities for vaccine adjuvant development:

Engineering Lipid A Immunostimulatory Properties:

  • Modulating LpxM activity can produce lipid A variants with altered TLR4 agonist activity

  • Lipid IVA (lacking LpxM modification) acts as a TLR4 antagonist in humans but an agonist in mice

  • Controlling the degree of acylation could fine-tune immune responses

Species-Specific Adjuvant Design:

  • LpxM-modified lipid A structures could be tailored for optimal immunostimulation in specific host species

  • Understanding species-specific TLR4-MD-2 interactions enables rational adjuvant design

  • This could improve vaccine efficacy in both human and veterinary applications

Controlled Inflammatory Responses:

  • Partial inhibition of LpxM could produce lipid A with reduced inflammatory potential

  • This could be valuable for vaccines where excessive inflammation is detrimental

  • The approach might balance immunostimulation with acceptable reactogenicity

Recombinant Production Systems:

  • Engineered bacterial strains with modified LpxM could produce custom lipid A adjuvants

  • Expression of heterologous LpxM variants could generate novel acylation patterns

  • This could enable large-scale production of designer immunomodulators

Combined Immunomodulatory Strategies:

  • LpxM modification could be combined with other lipid A modifications (phosphate removal, etc.)

  • This multi-parameter approach could generate adjuvants with precisely calibrated activity

  • Such adjuvants might be tailored for specific vaccine types or target populations

The potential applications extend beyond vaccines to broader immunomodulation strategies, including:

  • Treating autoimmune conditions by developing LpxM-modified lipid A antagonists

  • Managing sepsis by modulating TLR4 signaling with specific lipid A structures

  • Enhancing cancer immunotherapy by calibrating immune activation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.