Recombinant Lipid A biosynthesis lauroyl acyltransferase (htrB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
lpxL; htrB; waaM; Z1690; ECs1432; Lipid A biosynthesis lauroyltransferase; Kdo(2-lipid IV(A lauroyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
lpxL
Target Protein Sequence
MTNLPKFSTALLHPRYWLTWLGIGVLWLVVQLPYPVIYRLGCGLGKLALRFMKRRAKIVH RNLELCFPEMSEQERRKMVVKNFESVGMGLMETGMAWFWPDRRIARWTEVIGMEHIRDVQ AQKRGILLVGIHFLTLELGARQFGMQEPGIGVYRPNDNPLIDWLQTWGRLRSNKSMLDRK DLKGMIKALKKGEVVWYAPDHDYGPRSSVFVPLFAVEQAATTTGTWMLARMSGACLVPFV PRRKPDGKGYQLIMLPPECSPPLDDAETTAAWMNKVVEKCIMMAPEQYMWLHRRFKTRPE GVPSRY
Uniprot No.

Target Background

Function
Catalyzes the transfer of laurate from lauroyl-acyl carrier protein (ACP) to Kdo(2)-lipid IV(A), forming Kdo(2)-(lauroyl)-lipid IV(A).
Database Links

KEGG: ece:Z1690

STRING: 155864.Z1690

Protein Families
LpxL/LpxM/LpxP family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Lipid A biosynthesis lauroyl acyltransferase (htrB)?

Lipid A biosynthesis lauroyl acyltransferase (htrB/LpxL) is an essential enzyme in Gram-negative bacteria responsible for adding laurate (C12:0 fatty acid) to the glucosamine backbone of lipid A at specific positions. This enzyme, initially named for "high-temperature requirement B," catalyzes one of the late secondary acylation steps in lipid A biosynthesis after the formation of the Kdo₂-lipid IV₁ precursor . In E. coli, htrB specifically adds a secondary lauric acid to the 3-hydroxymyristic acid at the 2' position of the distal glucosamine on the lipid A structure . This modification is critical for maintaining the structural integrity and proper function of the bacterial outer membrane.

How does the function of htrB vary across bacterial species?

The function of htrB demonstrates interesting variation across bacterial species despite evolutionary conservation of the enzyme. In Escherichia coli, a single htrB gene mediates the addition of laurate (C12:0) at the 2'-O-position of lipid A . In contrast, Pseudomonas aeruginosa contains two homologs of the htrB gene (htrB1 and htrB2), each responsible for site-specific modifications of lipid A . This differential functionalization leads to species-specific lipid A structures that affect membrane properties and host interactions.

Studies comparing htrB from different bacteria show variations in substrate specificity. For example, when Vibrio fischeri htrB1 and htrB2 were expressed in E. coli mutants lacking secondary acylations on lipid A, they demonstrated different substrate specificities compared to E. coli HtrB . Mass spectrometry analysis revealed that these homologs incorporate different fatty acids, indicating evolutionary adaptation of these enzymes to specific bacterial membrane requirements .

What are the optimal methods for expressing and purifying recombinant htrB protein?

For high-quality recombinant htrB protein, E. coli-based expression systems with N-terminal histidine tags have proven effective for subsequent purification and functional studies . The following methodological approach is recommended:

  • Vector Selection: Construct an expression vector containing the full-length htrB gene (306 amino acids for E. coli htrB) fused to an N-terminal His-tag to facilitate purification .

  • Expression Conditions: Transform the construct into an E. coli expression strain optimized for membrane protein expression. Grow cultures at 30°C to mid-log phase before inducing with IPTG (0.1-0.5 mM). Lower induction temperatures (16-20°C) can improve proper folding of membrane-associated proteins like htrB.

  • Membrane Fraction Isolation: Harvest cells and disrupt by sonication or French press in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and protease inhibitors. Separate membrane fractions by ultracentrifugation (100,000 × g for 1 hour).

  • Protein Solubilization: Solubilize membrane fractions using detergents such as n-dodecyl-β-D-maltoside (DDM) or Triton X-100 at concentrations of 1-2% in the presence of 10-20% glycerol to stabilize protein structure.

  • Affinity Purification: Purify His-tagged htrB using nickel-nitrilotriacetic acid (Ni-NTA) affinity chromatography, washing with increasing imidazole concentrations (20-40 mM) and eluting with 250-300 mM imidazole.

  • Quality Control: Verify purity by SDS-PAGE and Western blotting using anti-His antibodies. Assess enzyme activity through acyltransferase assays measuring the incorporation of radiolabeled laurate onto lipid A precursors.

How can researchers effectively analyze site-specific acylation patterns in lipid A?

Analyzing site-specific acylation patterns in lipid A requires sophisticated analytical techniques. The following methodological approach has proven effective in research settings:

  • Lipid A Isolation: Extract lipid A from bacterial cultures using the Bligh and Dyer method followed by mild acid hydrolysis (1% acetic acid at 100°C for 1 hour) to cleave the Kdo-lipid A linkage .

  • Mass Spectrometry Analysis: Employ multiple-stage mass spectrometry, particularly MALDI-TOF MS and ESI-MS/MS, to identify and characterize lipid A structures . This approach allows researchers to:

    • Determine the molecular mass of intact lipid A species

    • Identify the position of acyl chains through fragmentation patterns

    • Quantify relative abundances of lipid A variants

  • Comparative Analysis: Generate lipid A profiles from wild-type and htrB mutant strains grown under various conditions to identify specific modifications dependent on htrB activity .

For example, in E. coli lpxL (htrB) mutants, MS analysis revealed atypical penta- and hexaacyl lipid A structures incorporating longer fatty acids such as secondary palmitoleic acid (at the 2'-O-position) and secondary palmitic acid (at the 2-O-position) at elevated temperatures, compensating for the lack of laurate addition .

Bacterial StrainGrowth TemperaturePrimary Lipid A StructureKey MS Signals (m/z)Dominant Acylation Pattern
E. coli WT37°CHexaacyl1797 (DPLA), 1717 (MPLA)4× 3-OH C14:0, 1× C14:0, 1× C12:0
E. coli lpxL mutant30°CTetra/Pentaacyl~1360-1580Lacks C12:0 at 2'-position
E. coli lpxL mutant37-42°CPenta/Hexaacyl~1580-1800Alternative acylation with C16:1 and C16:0

How do mutations in htrB affect bacterial membrane integrity and antibiotic resistance?

Mutations in htrB significantly alter bacterial membrane properties and antimicrobial susceptibility profiles through changes in lipid A structure. Deletion of htrB genes leads to several functional consequences:

  • Altered Membrane Permeability: Studies with Pseudomonas aeruginosa demonstrated that ΔhtrB1 and ΔhtrB2 mutants exhibit increased membrane permeability, allowing greater penetration of hydrophobic compounds and antibiotics . This is due to the lack of specific secondary acyl chains that normally contribute to tight packing of lipid A molecules in the outer membrane.

  • Changed Antimicrobial Peptide Resistance: HtrB mutants show altered resistance to cationic antimicrobial peptides (CAMPs) . The mechanism involves:

    • Modified surface charge of the outer membrane

    • Altered hydrophobic interactions between lipid A molecules

    • Disrupted membrane bilayer organization affecting peptide insertion and pore formation

  • Antibiotic Susceptibility: Research shows class-specific changes in antibiotic resistance profiles in htrB mutants . For example:

    • Increased susceptibility to hydrophobic antibiotics due to enhanced membrane permeability

    • Altered resistance to polymyxins and other membrane-targeting antimicrobials

  • Temperature Sensitivity: E. coli lpxL (htrB) mutants traditionally show impaired growth above 33°C in rich media, though some studies have demonstrated growth at higher temperatures through compensatory lipid A modifications . These adaptations involve incorporation of different fatty acids at positions normally acylated by HtrB.

These findings highlight the critical role of htrB-mediated lipid A acylation in maintaining optimal membrane organization and integrity for bacterial survival under various environmental conditions and antimicrobial challenges.

What is the relationship between temperature and htrB-mediated lipid A modifications?

Temperature exerts significant regulatory control over htrB-mediated lipid A modifications, revealing a sophisticated bacterial adaptation mechanism. This temperature-dependent regulation operates through multiple pathways:

  • Expression Regulation: The name "high-temperature requirement B" reflects that htrB expression is induced by heat stress . In Bacillus subtilis, HtrA and HtrB expression increases at elevated temperatures and during the stationary phase of growth .

  • Enzyme Activity Modulation: Temperature directly affects the catalytic activity of HtrB. In E. coli lpxL (htrB) mutants grown at different temperatures (30°C, 37°C, and 42°C), mass spectrometry analysis revealed temperature-dependent alterations in lipid A acylation patterns :

    • At 30°C: Predominant production of tetra- and pentaacylated lipid A lacking the secondary lauric acid

    • At 37°C and 42°C: Activation of alternative acyltransferases incorporating longer fatty acids (palmitoleic and palmitic acids) at specific positions

  • Compensatory Mechanisms: When htrB function is compromised, bacteria activate temperature-dependent compensatory pathways to maintain membrane integrity. These mechanisms become more pronounced at elevated temperatures, suggesting a heightened need for specific lipid A structures under these conditions .

The temperature-dependence of lipid A acylation indicates that bacteria have evolved sophisticated regulatory systems to modulate their membrane composition in response to environmental temperature changes, with htrB playing a central role in this adaptation process.

How can researchers differentiate the functions of multiple htrB homologs in bacterial species?

Differentiating the functions of multiple htrB homologs requires a multi-faceted approach combining genetic, biochemical, and analytical techniques. The following methodological framework has proven effective:

  • Genetic Deletion Analysis: Generate single and combination knockout mutants of each htrB homolog using techniques such as allelic exchange or CRISPR-Cas9 mediated genome editing . In Pseudomonas aeruginosa, this approach revealed that htrB1 and htrB2 have distinct functions in lipid A modification .

  • Complementation Studies: Express individual htrB homologs in heterologous systems or in mutant backgrounds lacking endogenous acyltransferase activity. For example, expressing Vibrio fischeri htrB1 and htrB2 in E. coli mutants lacking secondary acylations (htrB::Tn10 msbB::cam lpxP::kan) demonstrated different substrate specificities for these homologs .

  • Mass Spectrometry Analysis: Employ multiple-stage mass spectrometry to precisely characterize lipid A structures from wild-type and mutant strains . This allows:

    • Identification of site-specific modifications mediated by each homolog

    • Determination of acyl chain composition and position

    • Quantification of different lipid A species

  • Expression Profiling: Use quantitative RT-PCR or RNA-Seq to analyze expression patterns of htrB homologs under different conditions, revealing potential specialization in response to specific environmental cues .

  • Functional Assays: Assess the physiological consequences of mutations in different htrB homologs through:

    • Antimicrobial susceptibility testing

    • Membrane permeability assays using fluorescent dyes

    • Growth analyses under various stress conditions

For example, in Pseudomonas aeruginosa, analysis of lipid A from ΔhtrB1 and ΔhtrB2 mutants revealed that each enzyme adds a specific fatty acid at a distinct position on the lipid A backbone, demonstrating site-specific activity despite sequence homology .

What role does htrB play in bacterial pathogenesis and host-pathogen interactions?

HtrB plays a significant role in bacterial pathogenesis through its impact on lipid A structure, which directly influences host-pathogen interactions:

  • Immune Recognition and Evasion: Lipid A is recognized by host pattern recognition receptors, particularly Toll-like receptor 4 (TLR4). The acylation pattern mediated by htrB significantly affects this recognition process . Modifications in acylation can:

    • Alter inflammatory responses triggered through TLR4 signaling

    • Influence cytokine production profiles

    • Affect recruitment of immune cells to infection sites

  • Membrane Remodeling During Infection: Bacteria can actively modify their lipid A structure through regulated htrB activity in response to host environments . This remodeling:

    • Enhances resistance to host antimicrobial peptides

    • Promotes bacterial survival within host tissues

    • Contributes to persistent infections

  • Environmental Adaptation: HtrB-mediated lipid A modifications help bacteria adapt to changing conditions during infection, including:

    • Temperature shifts (from environmental to host body temperature)

    • pH changes in different host compartments

    • Presence of antimicrobial molecules and stress factors

  • Virulence Factor Expression: Studies suggest that lipid A structure can influence the expression and secretion of other virulence factors, creating a coordinated response during pathogenesis .

  • Biofilm Formation: Alterations in lipid A structure mediated by htrB can affect bacterial surface properties relevant to biofilm formation and maintenance, which is critical for chronic infections .

Research approaches to investigate these aspects include infection models with wild-type and htrB mutant bacteria, analysis of host immune responses, and in vivo imaging to track bacterial persistence and spread within host tissues.

How can htrB be targeted for potential antimicrobial development?

The essential role of htrB in maintaining bacterial membrane integrity makes it a promising target for novel antimicrobial development. Research strategies in this direction include:

Researchers investigating htrB as an antimicrobial target should consider the potential for compensatory mechanisms, as demonstrated by E. coli lpxL mutants that activate alternative acylation pathways at elevated temperatures .

What are the latest methodologies for studying htrB-dependent membrane remodeling?

Advanced methodologies for studying htrB-dependent membrane remodeling combine cutting-edge analytical techniques with sophisticated biological assays:

  • Lipidomics Approaches: High-resolution lipidomics using liquid chromatography coupled with tandem mass spectrometry (LC-MS/MS) enables comprehensive profiling of membrane lipids, including minor species resulting from htrB activity or its absence . This approach allows:

    • Identification of novel lipid A variants

    • Quantification of lipid species across different growth conditions

    • Temporal analysis of membrane remodeling dynamics

  • Advanced Microscopy Techniques: Super-resolution microscopy and atomic force microscopy (AFM) can visualize and measure physical properties of bacterial membranes affected by htrB-mediated lipid A modifications:

    • Membrane fluidity and domain organization

    • Nanoscale surface topography

    • Mechanical properties such as stiffness and elasticity

  • Molecular Dynamics Simulations: Computational modeling of outer membranes with different lipid A structures provides insights into how htrB-mediated acylation affects:

    • Membrane packing and stability

    • Interactions with antimicrobial peptides

    • Permeability to various compounds

  • Reconstitution Systems: In vitro reconstitution of htrB activity using purified components allows precise control over reaction conditions and facilitates mechanistic studies:

    • Kinetic analysis of acyltransferase activity

    • Identification of regulatory factors

    • Evaluation of potential inhibitors

  • Single-Cell Techniques: Fluorescence-based reporters and microfluidic systems enable analysis of htrB-dependent processes at the single-cell level, revealing population heterogeneity in membrane composition and stress responses.

These methodologies provide researchers with powerful tools to understand the complex relationships between htrB activity, lipid A structure, membrane properties, and bacterial physiology under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.