Recombinant Lipid A export ATP-binding/permease protein MsbA (msbA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Lipid A export ATP-binding/permease protein MsbA (msbA) is a genetically engineered version of the essential ATP-binding cassette (ABC) transporter found in Gram-negative bacteria. MsbA facilitates the ATP-dependent translocation of lipid A—a critical component of lipopolysaccharides (LPS)—from the cytoplasmic to the periplasmic leaflet of the inner membrane . This process is vital for outer membrane biogenesis and bacterial viability, making MsbA a potential target for novel antibiotics .

Domain Architecture

MsbA functions as a homodimer, with each subunit comprising:

  • Transmembrane domain (TMD): Forms a lipid translocation pathway through 12 α-helices .

  • Nucleotide-binding domain (NBD): Binds and hydrolyzes ATP to energize transport .

Conformational Dynamics

Structural studies reveal MsbA adopts multiple conformations:

ConformationResolution (Å)Key FeaturesSubstrate InteractionSource
Inward-facing2.8Wide transmembrane portal for lipid A entryLipid A observed in central cavity X-ray (Salmonella typhimurium)
Outward-facing4.2Compact NBDs, periplasmic gate closureLipid A near periplasmic cleft Cryo-EM (E. coli)
AMPPNP-bound3.7Intermediate NBD separationATP analog stabilizes post-hydrolysis state X-ray (Vibrio cholerae)

The "trap-and-flip" model posits that MsbA captures lipid A in its inward-facing state, undergoes ATP-driven conformational changes, and releases it into the outer leaflet .

ATPase Activity

  • Basal activity: Purified MsbA exhibits ATP hydrolysis rates of 1.7–5.3 µmol/min/mg, depending on species .

  • Stimulation by lipids: Phospholipids (e.g., phosphatidylethanolamine) and lipid A increase V<sub>max</sub> by 3–4 fold and reduce K<sub>m</sub> for ATP by 50% .

Substrate Specificity

MsbA transports:

  • Lipid A (K<sub>d</sub> ≈ 5 µM)

  • Phospholipids (phosphatidylserine, phosphatidylcholine)

  • Amphipathic drugs (Hoechst 33342, ethidium)

Biochemical Properties of Recombinant MsbA

Recombinant MsbA is typically expressed in E. coli with an N-terminal hexahistidine tag for purification . Key properties include:

ParameterDetails
Molecular Weight~65 kDa per monomer
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRequires 5–50% glycerol for stability; functional in E. coli lipid proteoliposomes

Lipid A Transport Mechanism

  • Cryo-EM structures show lipid A deeply embedded in MsbA’s TMDs via hydrophobic interactions, reaching the periplasmic leaflet without flipping .

  • Mutations in Walker B motifs (e.g., D173N) abolish ATPase activity but retain substrate binding .

Drug Efflux Capability

MsbA confers resistance to:

  • Antibiotics: Erythromycin, novobiocin

  • Inhibitors: Quinoline-based compound G907 reduces ATPase activity by 80% at 10 µM .

Reconstitution Studies

  • Proteoliposomes containing MsbA flip NBD-labeled phospholipids at rates up to 2.4 nmol/min/mg .

  • Activity is optimal in bilayers containing >50% phosphatidylethanolamine .

Antibiotic Development

MsbA’s essential role in LPS transport makes it a high-priority target. Inhibitors like G907 disrupt ATPase activity and ion flow, as demonstrated by electrochemical impedance spectroscopy .

Challenges and Future Directions

  • Substrate promiscuity: MsbA transports diverse lipids and drugs, complicating inhibitor design .

  • Conformational flexibility: Dynamics between inward- and outward-facing states require advanced techniques like time-resolved crystallography .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
msbA; XOO2297; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Target Names
msbA
Target Protein Sequence
MTNSTDRPVSVSSWRTYRRLVAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAIKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAVALTRAKGLIEFRDVTARYPGQVN PALADVSFIAQPGTVTAIVGRSGSGKSSLIKLIPRFYDAEAGQILLDGQPVQAYALADLR RQIALVGQQVMLFDGSIAENVAFGEMRSADASQLERAILGANAMEFVAQLPEGLQSHVGA KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHELLAQGGLYSHLHGMQFRERQA
Uniprot No.

Target Background

Function
MsbA plays a crucial role in lipopolysaccharide (LPS) biosynthesis. It facilitates the translocation of lipid A-core from the inner to the outer leaflet of the inner membrane. The transmembrane domains (TMD) form a pore within the inner membrane, while the ATP-binding domain (NBD) is responsible for energy generation.
Database Links

KEGG: xoo:XOO2297

Protein Families
ABC transporter superfamily, Lipid exporter (TC 3.A.1.106) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental function of MsbA in bacterial cell membranes?

MsbA functions as an essential lipid flippase that transports lipid A with or without core sugars from the cytoplasmic leaflet to the periplasmic leaflet of the inner membrane in gram-negative bacteria. This transport activity is energy-dependent, utilizing ATP hydrolysis through its ABC transporter mechanism. MsbA plays a critical role in the biogenesis of the bacterial outer membrane, as lipid A forms the anchor for lipopolysaccharide (LPS), a major component of the outer leaflet of the outer membrane in gram-negative bacteria .

The transport process is part of a larger pathway: after MsbA flips lipid A to the periplasmic side, O-antigen is ligated to the lipid A core, and the completed LPS is delivered to the cell surface by the Lpt transport complex (Lpt A-G) that spans from the inner membrane to the outer membrane . Beyond lipid A transport, some evidence suggests MsbA may also function as a flippase for glycerophospholipids, though its primary physiological substrate is lipid A .

How do researchers express and purify recombinant MsbA for structural studies?

Recombinant MsbA expression typically employs bacterial expression systems, most commonly using E. coli strains optimized for membrane protein expression. The protein is usually expressed with affinity tags (such as His6 or FLAG) to facilitate purification. After cell lysis, membrane fractions are isolated through differential centrifugation, and the membrane protein is solubilized using detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG).

Purification generally follows a multi-step approach:

  • Affinity chromatography (e.g., Ni-NTA for His-tagged constructs)

  • Size exclusion chromatography to separate protein-detergent complexes

  • Optional ion exchange chromatography for further purification

For structural studies requiring stable protein samples, researchers often employ facial amphiphiles as stabilizing agents, which was successfully used in obtaining the 2.8 Å resolution structure of MsbA from Salmonella typhimurium . The choice of detergent and stabilizing amphiphiles is critical, as they must maintain the protein in a functional state while allowing for crystal formation or suitable samples for cryo-EM analysis.

What experimental approaches can be used to assess MsbA transport activity?

Several complementary approaches are used to evaluate MsbA transport activity:

  • In vivo transport assays: Monitoring the accumulation of lipid A in the inner membrane of MsbA-deficient strains or strains expressing mutant MsbA proteins. This can be done through radiolabeling of lipid A precursors and subsequent membrane fractionation and analysis.

  • Reconstituted liposome assays: Purified MsbA is reconstituted into liposomes with fluorescently labeled lipid substrates. Transport activity can be measured by monitoring changes in fluorescence upon ATP addition.

  • ATPase activity assays: Since MsbA transport is coupled to ATP hydrolysis, measuring ATPase activity provides an indirect measure of transport function. This is typically done using colorimetric assays that detect inorganic phosphate release.

  • Binding assays: Isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) can be used to measure binding affinities of MsbA for lipid substrates and nucleotides.

A comparison of these approaches reveals different aspects of MsbA function:

MethodMeasuresAdvantagesLimitations
In vivo transportPhysiological functionMost relevant to natural functionIndirect; affected by other cellular factors
Liposome assaysDirect transportControlled environmentTechnical challenges in reconstitution
ATPase assaysEnzymatic activityHigh throughput; quantitativeIndirect measure of transport
Binding assaysSubstrate/nucleotide affinityDirect biophysical dataDoes not confirm transport

These complementary approaches provide researchers with a comprehensive toolkit to investigate MsbA transport mechanisms under different experimental conditions .

How do the different conformational states of MsbA contribute to the "trap and flip" mechanism of lipid transport?

The "trap and flip" mechanism of MsbA-mediated lipid transport is supported by structural evidence from various conformational states observed in X-ray crystallography and cryo-EM studies. In the inward-facing conformation observed in the 2.8 Å resolution structure, MsbA displays a large amplitude opening in the transmembrane portal . This opening is critical for allowing lipid A to enter from the cytoplasmic leaflet into the protein-enclosed transport pathway. The structure reveals putative lipid A density inside the transmembrane cavity, consistent with the substrate being "trapped" within the protein .

The conformational cycle progresses as follows:

  • In the nucleotide-free state, MsbA adopts an inward-facing conformation with separated nucleotide-binding domains (NBDs) and a cytoplasmic-facing central cavity

  • Lipid A binding in this cavity triggers conformational changes

  • ATP binding brings the NBDs together, transitioning the protein to an outward-facing conformation

  • This conformational change reorients the bound lipid toward the periplasmic side of the membrane, effectively "flipping" it

  • ATP hydrolysis and release returns MsbA to the inward-facing conformation

Interestingly, the 2.8 Å structure also showed additional electron density attributed to lipid A near an outer surface cleft at the periplasmic ends of the transmembrane helices, suggesting a potential exit site for the flipped lipid . This observation provides crucial structural evidence for the complete transport pathway.

The wide-open conformation observed in the earlier 5.3 Å structure (PDB: 3B5W) with large NBD separation has been debated regarding its physiological relevance . Comparative analysis with newer structures suggests this extreme separation may represent a transient state that facilitates the entry of the bulky lipid A substrate.

What are the most effective approaches for studying MsbA inhibitors as potential antibiotics?

Given MsbA's essential role in gram-negative bacteria, it represents a promising antibiotic target . Research approaches for studying MsbA inhibitors include:

  • High-throughput screening (HTS): Libraries of compounds can be screened against purified MsbA using ATPase activity assays. Primary hits are compounds that significantly inhibit ATPase activity.

  • Structure-based drug design: Utilizing the high-resolution structures of MsbA to identify potential binding pockets and design molecules that can interfere with either substrate binding or conformational changes required for transport.

  • Fragment-based screening: Using biophysical methods such as NMR or X-ray crystallography to identify small molecular fragments that bind to MsbA, which can then be elaborated into more potent inhibitors.

  • Phenotypic screening: Testing compounds for growth inhibition in wild-type bacteria versus strains with modified MsbA expression can identify compounds that specifically target MsbA function.

  • Computational approaches: Molecular dynamics simulations can identify transient pockets and predict binding modes of potential inhibitors.

The most rigorous validation approach combines:

  • Biochemical assays (ATPase activity, transport assays)

  • Structural studies (co-crystallization with inhibitors)

  • Microbiological assays (MIC determination, resistance development)

  • In vivo efficacy in infection models

ApproachKey AdvantagesTechnical Challenges
Biochemical screeningDirect target engagementMay not translate to cellular activity
Structural studiesMechanism of action insightsRequires stable protein-inhibitor complexes
Microbiological assaysCellular efficacyTarget specificity confirmation difficult
Molecular dynamicsCaptures protein flexibilityComputational cost; validation required

Successful inhibitor development must address the challenges of membrane penetration and efflux pump avoidance that are common to gram-negative antibiotic development .

How can researchers effectively compare and interpret seemingly contradictory structural data for MsbA from different experimental approaches?

Interpreting contradictory structural data for MsbA requires systematic analysis of differences in experimental conditions and methodologies:

  • Expression and purification conditions: Different detergents, stabilizing agents, and buffer conditions can significantly affect the conformational state of membrane proteins. For instance, the 2.8 Å structure utilized a facial amphiphile stabilizer that may have influenced the observed conformation .

  • Method-specific artifacts: Crystal packing forces in X-ray crystallography can constrain protein conformations, while grid preparation for cryo-EM may favor certain conformations due to air-water interface effects.

  • Presence of binding partners: The absence or presence of lipid A, nucleotides, or inhibitors will capture different functional states of the transporter. The 2.8 Å structure was obtained after co-crystallization with lipid A, while earlier structures were solved without the substrate .

  • Resolution limitations: Lower resolution structures (like the 5.3 Å structure) may lack the detail needed to accurately position side chains and flexible regions, leading to model inaccuracies .

To reconcile contradictory data, researchers should:

  • Perform comparative analysis of all available structures

  • Validate structural models through independent biophysical methods (DEER spectroscopy, HDX-MS)

  • Use molecular dynamics simulations to explore conformational flexibility

  • Conduct cross-linking studies to validate proximity relationships between domains

  • Design functional studies that test predictions from each structural model

The 2.8 Å structure should be interpreted in context with cryo-EM structures and the earlier 5.3 Å structure, recognizing that the physiological transport cycle likely involves all observed conformations at different stages . The apparent contradiction between the extreme NBD separation in the 5.3 Å structure and more moderate separations in other structures may represent different states along the transport pathway rather than experimental artifacts.

What experimental approaches can distinguish between MsbA's role in lipid A transport versus glycerophospholipid flipping?

Distinguishing between MsbA's specificity for lipid A versus glycerophospholipids requires carefully designed experiments:

  • Substrate competition assays: Using purified MsbA reconstituted in liposomes, researchers can measure transport rates of fluorescently-labeled lipid A in the presence of increasing concentrations of unlabeled glycerophospholipids (and vice versa). True substrates will compete effectively.

  • Binding affinity measurements: Isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) can determine relative binding affinities of different lipid substrates to purified MsbA.

  • Site-directed mutagenesis: By mutating residues in the predicted substrate-binding pocket based on structural data, researchers can potentially create variants with altered substrate selectivity. These variants can then be tested in both in vitro and in vivo assays.

  • In vivo transport assays with specific substrates: Using bacterial strains with temperature-sensitive MsbA mutants, researchers can monitor the accumulation of lipid A versus glycerophospholipids in the inner membrane at non-permissive temperatures.

  • Structural studies with different substrates: Co-crystallization or cryo-EM analysis of MsbA bound to different substrates can reveal binding mode differences and structural adaptations.

SubstrateExperimental Evidence for TransportRelative AffinityPhysiological Relevance
Lipid AStrong in vivo and in vitro evidenceHigh (KD ~μM range)Essential for bacterial viability
GlycerophospholipidsLimited evidence from specific assaysLower (KD ~mM range)Possibly supplementary to dedicated flippases
Other lipidsMinimal evidenceVery lowUnlikely physiological substrates

Current evidence strongly supports lipid A as the primary physiological substrate, while the role in glycerophospholipid transport remains less clear and may be secondary or context-dependent .

How can researchers effectively generate and characterize MsbA mutants to probe structure-function relationships?

Generating informative MsbA mutants requires strategic selection of mutation sites based on structural and functional data:

  • Selection of mutation sites:

    • Transmembrane portal residues potentially involved in lipid A entry

    • Putative lipid-binding residues in the central cavity

    • Conserved motifs in the NBDs (Walker A, Walker B, signature motifs)

    • Residues at domain interfaces involved in conformational changes

    • Periplasmic cleft residues potentially involved in lipid exit

  • Mutation strategies:

    • Alanine scanning of predicted functional regions

    • Conservative substitutions to probe specific interactions

    • Introduction of cysteine pairs for cross-linking studies

    • Charge reversal mutations to test electrostatic interactions

  • Expression and purification:

    • Use systems optimized for membrane protein expression

    • Compare expression levels and stability with wild-type protein

    • Assess protein folding via circular dichroism or limited proteolysis

  • Functional characterization:

    • ATPase activity assays to determine catalytic efficiency

    • Transport assays in reconstituted systems

    • Binding assays for substrate and nucleotide interactions

    • Thermostability measurements to assess structural integrity

  • Structural analysis:

    • Crystallography or cryo-EM of informative mutants

    • EPR spectroscopy to monitor conformational changes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to assess dynamics

Mutation CategoryExperimental ApproachExpected OutcomeInterpretation
NBD catalytic residuesATPase assaysReduced ATP hydrolysisConfirms role in catalysis
TMD portal residuesTransport assaysReduced lipid A transportConfirms substrate entry pathway
Periplasmic cleft residuesTransport assaysReduced transport; substrate accumulationConfirms exit pathway
Domain interface residuesEPR/FRET studiesAltered conformational changesConfirms role in structural transitions

This comprehensive approach allows researchers to systematically probe the structural basis of MsbA function and map the complete transport pathway from substrate entry to exit .

What are the optimal approaches for studying MsbA in native-like membrane environments?

Studying MsbA in native-like environments overcomes limitations of detergent-solubilized systems:

  • Nanodiscs:

    • MsbA can be reconstituted into nanodiscs using membrane scaffold proteins (MSPs) and defined lipid compositions

    • This provides a bilayer environment while maintaining accessibility for functional studies

    • Nanodiscs are compatible with various biophysical techniques including single-molecule FRET, SPR, and cryo-EM

    • The lipid composition can be systematically varied to study lipid effects on MsbA function

  • Proteoliposomes:

    • Reconstitution into liposomes allows assessment of vectorial transport

    • Inside-out vesicles can be prepared to study cytoplasmic-to-periplasmic transport

    • Fluorescently labeled lipids can be incorporated to monitor flipping activity

    • Proton gradients can be established to study potential coupling with transport

  • Native membrane vesicles:

    • Preparation of inverted membrane vesicles from cells expressing MsbA

    • Maintains the native lipid environment and potential interacting proteins

    • Suitable for transport assays and ATPase activity measurements

    • Limited control over protein density and orientation

  • Lipid cubic phase (LCP):

    • Useful for both functional studies and crystallization attempts

    • Provides a membrane-like environment while allowing diffusion of small molecules

    • Has been successfully used for other ABC transporters

  • Styrene-maleic acid lipid particles (SMALPs):

    • Allows extraction of MsbA directly from membranes with surrounding native lipids

    • Avoids detergent use entirely, potentially better preserving native interactions

    • Compatible with various biophysical and structural techniques

Membrane MimeticAdvantagesLimitationsSuitable Techniques
NanodiscsDefined size and composition; bilayer structureRequires optimization of MSP:lipid:protein ratiosCryo-EM, FRET, ATPase assays
ProteoliposomesVectorial transport studies possibleHeterogeneous size; limited accessibilityTransport assays, ATPase activity
Native vesiclesNatural lipid environmentLimited control; presence of other proteinsTransport assays, in vivo relevance
LCPMembrane-like; suitable for crystallizationComplex preparation; limited dynamicsX-ray crystallography
SMALPsPreserves native lipid interactionsRelatively new technique; size limitationsCryo-EM, mass spectrometry

These native-like systems are particularly important for MsbA given evidence that its function is sensitive to the lipid environment, as suggested by the observation of lipid A density in multiple locations in structural studies .

What are the most significant unresolved questions in MsbA research?

Despite significant progress in understanding MsbA structure and function, several key questions remain unresolved:

  • Complete conformational cycle mapping: While structures exist for several states, a complete understanding of all conformational transitions during the transport cycle remains elusive. Particularly, the energy landscape governing these transitions and the coupling between ATP hydrolysis and substrate movement needs further elucidation.

  • Substrate specificity determinants: The molecular basis for preferential transport of lipid A over glycerophospholipids is not fully understood. Structural features conferring this specificity and the extent of promiscuity toward different lipid substrates require further investigation.

  • Coupling mechanism: How ATP binding and hydrolysis are precisely coupled to conformational changes that drive lipid flipping remains incompletely characterized, particularly the sequence and energetics of these events.

  • Regulatory mechanisms: Whether MsbA activity is regulated by cellular factors, stress conditions, or other physiological parameters is poorly understood, as are potential post-translational modifications that might influence its function.

  • Species-specific differences: The extent of functional and structural conservation across MsbA homologs from different bacterial species, especially pathogenic bacteria, requires systematic comparative analysis to inform antibiotic development strategies.

Addressing these questions will require integrative approaches combining structural biology, molecular dynamics simulations, advanced spectroscopic techniques, and in vivo functional studies. The contradictions observed between different structural studies highlight the importance of capturing the dynamic nature of this transporter through complementary experimental approaches .

How can researchers effectively translate MsbA structural insights into antibiotic development strategies?

Translating structural insights into effective antibiotic development requires a multidisciplinary approach:

  • Structure-based inhibitor design:

    • Target specific conformational states revealed in structures

    • Focus on regions unique to bacterial transporters versus human homologs

    • Design compounds that stabilize non-functional conformations

    • Utilize the large amplitude opening in the transmembrane portal as a potential druggable site

  • Rational development pathways:

    • Screen for compounds that disrupt specific steps in the transport cycle

    • Develop assays that distinguish between different modes of inhibition

    • Use structure-activity relationships to optimize lead compounds

    • Employ fragment-based approaches to explore diverse chemical space

  • Addressing gram-negative permeability challenges:

    • Design inhibitors that access MsbA from the periplasmic side

    • Utilize the bacterial uptake pathways (porins, transporters)

    • Develop prodrug approaches specific for bacterial activation

    • Consider dual-targeting strategies to overcome resistance

  • Combination approaches:

    • Identify synergistic combinations with existing antibiotics

    • Target multiple steps in the LPS transport pathway

    • Combine MsbA inhibitors with efflux pump inhibitors

    • Develop adjuvants that enhance outer membrane permeability

The structural observation of lipid A binding sites both in the central cavity and near the periplasmic cleft offers multiple potential targets for inhibitor design . Additionally, the essential nature of MsbA makes it less likely for bacteria to develop resistance through target modification, although increased efflux or altered membrane permeability could still confer resistance to MsbA-targeting compounds.

Successful translation will require close collaboration between structural biologists, medicinal chemists, microbiologists, and pharmacologists to address both target engagement and the unique challenges of developing antibiotics effective against gram-negative pathogens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.